(data stored in ACNUC1104 zone)

EMBL: AP008957.PE654

AP008957.PE654       Location/Qualifiers
FT   CDS_pept        complement(733079..733651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31362"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN4"
FT                   /protein_id="BAH31362.1"
FT                   /translation="MSGPHIVDLCHTNSRKAHIMRSLRTPLALLAVGAALFATIASGET
FT                   DEAKKVDDNGSSAAPAAAFGIGDVVELGDWRVQVHGVVDPYVSTNQFITADPGNRYVVV
FT                   DTEVTNNSDKPSTVSSMMCFELQDSTNKSYNITFTDSSTSSVDGELAPGAAKRGELAYE
FT                   VPEAATGLRLQFKCDLFSSGSATINLS"
     gtgagcggtc cccacatcgt tgacttgtgc cataccaact ctcgaaaggc gcacatcatg        60
     cgatcactcc gtactcccct cgccctcctc gccgtcggcg cagccctgtt cgcaaccatc       120
     gcctcgggcg agaccgacga agcgaagaag gtcgacgaca acggttcttc cgccgcaccc       180
     gcggctgcct tcggcatcgg tgacgtcgtc gaactgggcg actggcgcgt ccaggtacac       240
     ggcgttgtcg atccctatgt ctcgaccaat cagttcatca ccgcggatcc cggaaaccgc       300
     tacgtcgtgg tcgacaccga ggtcaccaac aacagcgaca agccgtcgac tgtgtcatcg       360
     atgatgtgct tcgaactgca ggactcgacc aacaagtcgt acaacatcac gttcaccgac       420
     agcagcacgt cgagtgtcga cggagagctt gcgccgggtg cagccaagcg aggcgaattg       480
     gcgtacgagg tccccgaagc cgccaccggt cttcgccttc agttcaagtg cgacctgttc       540
     tcgtccggct cggcaaccat caacctgtcg tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page