(data stored in ACNUC1104 zone)

EMBL: AP008957.PE657

AP008957.PE657       Location/Qualifiers
FT   CDS_pept        735717..736376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31365"
FT                   /db_xref="GOA:C0ZPN7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN7"
FT                   /protein_id="BAH31365.1"
FT                   /translation="MTDQIVIDQDVTIEVWSDVACPWCYIGKTRFLSALDRFENKDRVN
FT                   VIWRSYQLAPETPVGEGRTELDALVEMKGMAPDQVRQMFAHVSATAAEVGLTLDFETVI
FT                   AANTFDAHRLLHLAGERQNELLEALFKAHFSDGLVIDDREVLVELAVSVGLDADVVREQ
FT                   LGSDAAAEAVREDLSMARQLQVSGVPFFVANRAVAVSGAQPEEVFLQLLTQASEPA"
     gtgactgatc aaatcgtgat tgaccaagac gtgaccatcg aagtgtggtc ggacgtcgct        60
     tgtccgtggt gctacatcgg aaagaccagg ttcctctcgg cgctggatcg tttcgagaac       120
     aaggaccgcg tcaacgtcat ctggcgctcg taccagctcg ctccggagac cccggtggga       180
     gaggggcgaa ccgaactcga cgccttggtc gaaatgaagg ggatggcgcc tgatcaggta       240
     cgtcagatgt tcgcccacgt cagcgcgacg gccgccgagg tcgggttgac cttggacttc       300
     gaaaccgtga tcgccgccaa tacctttgat gcgcacaggt tgctgcatct cgcgggtgag       360
     cggcagaacg aactcctcga agcgctgttc aaagcgcact tcagcgacgg cttggtgatc       420
     gacgaccgtg aggtgctggt cgagctggcc gtgagcgtcg gcctcgacgc cgatgtcgtg       480
     cgcgagcaac tgggctccga tgccgcagcg gaggctgtcc gcgaagatct gtccatggcc       540
     cgccaactgc aggtcagcgg cgttccgttc tttgtcgcca accgtgcggt tgccgtgtcc       600
     ggcgctcagc ccgaagaggt gtttctgcag ttgctcactc aggcctccga accggcctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page