(data stored in ACNUC1104 zone)

EMBL: AP008957.PE66

AP008957.PE66        Location/Qualifiers
FT   CDS_pept        83532..84629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00660"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30774"
FT                   /db_xref="GOA:C0ZL84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL84"
FT                   /protein_id="BAH30774.1"
FT                   /translation="MTTSVQNGVPLLQADNIRTVFATPRGQLRAVDGVSIHVSAGETLG
FT                   IVGESGSGKSVLGRTIMGLLQKGPALDISGTVTFAGRDMSTMKKSEMKHFWGPEIAMVF
FT                   QDPMTSLNPFKRIGTHITESLKFHLGLKKDAARDRAAELLSMVGIPEPKRRLDQYPHEL
FT                   SGGMRQRVVIAMALACEPKLLIADEPTTALDVTVQKQILDLLASLNDKLNMAVILISHD
FT                   LGVVSGRSDRVAVMYAGSVVETSATEELFTRPRHPYTEALMAAIPRLESPTHTVLQTIP
FT                   GGLPDMTKPITGCRFAARCRYAQDDCLTGEPALAPGGLGDNTTESHTFACHYPVDTPEG
FT                   TTALVANEKAGTTAAGLSLAVKEMV"
     gtgaccactt cagttcagaa cggcgttccg ctactgcagg cggacaacat caggaccgta        60
     ttcgccactc cgcgtggcca gttgcgagca gtcgacggtg tctcgatcca cgtttccgcc       120
     ggtgaaactc tcggtatcgt gggtgaatcc ggttccggca agtcggttct cgggcgcacc       180
     atcatgggtc tgctgcagaa gggtccggct ctggacatca gcgggacggt gacgtttgcc       240
     ggccgcgaca tgtcgaccat gaagaagtcg gagatgaagc acttctgggg acccgagatc       300
     gccatggtct tccaggatcc gatgacctcg ctcaatccgt tcaagcgcat cggtacccac       360
     atcaccgaat ccttgaagtt ccacctgggt ctgaagaagg acgcggcccg cgatcgcgct       420
     gcggaactcc tgtcgatggt gggtatcccc gagcccaagc gtcggctcga tcagtacccc       480
     cacgaacttt cgggcggtat gcgtcagcgt gtggtcatcg cgatggccct ggcctgcgag       540
     ccgaaactgc tgatcgcgga cgagccgacc acagcgctcg acgtgaccgt gcagaagcag       600
     atcctcgacc tgctcgcctc gctcaacgac aagctcaaca tggccgtcat cctgatcagc       660
     cacgacctcg gtgtggtctc gggacgatcg gatcgcgtcg ccgtcatgta cgccgggtcc       720
     gtcgtggaaa cgtcggccac cgaggagttg ttcactcgtc cgcgccaccc gtacaccgaa       780
     gcgctgatgg ccgcgattcc gcgactcgaa tcgccgacgc acacagtgct gcagacaatt       840
     ccgggtggac tgccggacat gacgaagccg atcaccggtt gccgcttcgc cgctcgctgc       900
     cggtatgccc aggacgactg cctgaccggc gaaccggctc tggctcccgg cggcctggga       960
     gacaacacaa ccgaaagcca cacgttcgcg tgccactacc cggtcgacac ccctgaaggc      1020
     acaacggcat tggtcgccaa cgagaaggcc ggcactaccg cagcgggcct ctcgctcgcg      1080
     gtgaaggaga tggtctga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page