(data stored in ACNUC1104 zone)

EMBL: AP008957.PE662

AP008957.PE662       Location/Qualifiers
FT   CDS_pept        complement(741881..742657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06620"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31370"
FT                   /db_xref="GOA:C0ZPP2"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP2"
FT                   /protein_id="BAH31370.1"
FT                   /translation="MPLVDNFTKLLIRGLLAGLIAGILAGGVAFVLGEPHVNAAIAIEE
FT                   ANSATGEVAGEAAGHSHGDEEEPLVSRDGQRAGLFLATALAGLALGAIFSVVANYARRL
FT                   TGMSGPLLAITIAVGGWLAIEAVPFFKYPANPPAVGDPDTINQRTLLWLAAVILGLLSV
FT                   TAAAAAAKAVSGHEFLSVRIAAPVAAFLVIATIGYVSLPGINEVGEDFPATLLWEFRLS
FT                   SLATQATLWLVLGLAFAFLTERATKNTEVAKKYALR"
     gtgccactag tcgacaattt cacgaagctt ctcattcgtg gtttgttggc tggtttgatc        60
     gcaggcatcc ttgccggcgg agttgcattc gtgctgggtg aaccgcacgt caatgccgcc       120
     attgcgatcg aagaagccaa cagcgctacc ggtgaggttg ccggcgaagc cgctgggcat       180
     tcgcacggtg acgaagaaga accactggtg agccgcgacg ggcagcgcgc cgggctgttc       240
     ctggccacgg cgttggccgg actggcactc ggggcgatct tctcggtcgt tgccaattac       300
     gctcgacgac tcaccggcat gtccgggccg ttgttggcga tcaccatcgc cgtcggtggt       360
     tggctggcca tcgaggccgt gcccttcttc aagtacccgg ccaatccgcc ggccgtcgga       420
     gatcccgaca ccatcaacca gcgcacactg ctgtggctgg ccgccgtgat tctcgggcta       480
     ctgtccgtca ccgcggcagc agcggcggca aaggcagttt ccgggcacga gttcctcagc       540
     gtgcgcatcg ctgctccggt ggctgcgttc ctggtgatcg ccacgatcgg ttacgtctcg       600
     cttcccggca tcaacgaggt gggcgaggac ttcccggcaa ctctgctgtg ggagttccga       660
     ctttcctcgc tcgctacgca ggcgacgctc tggctcgtgc tcgggttggc attcgccttc       720
     ctcaccgagc gcgcgaccaa gaacaccgaa gtagcaaaga agtacgccct tcgctga          777
//

If you have problems or comments...

PBIL Back to PBIL home page