(data stored in ACNUC1104 zone)

EMBL: AP008957.PE681

AP008957.PE681       Location/Qualifiers
FT   CDS_pept        760299..761042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31389"
FT                   /db_xref="GOA:C0ZPR1"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR1"
FT                   /protein_id="BAH31389.1"
FT                   /translation="MLEPNGPLPPEIYWRRRALAIGAAVIALALIIWAASALFGGGSDT
FT                   PEANSAAASSSLTTDVSFTPNPSGSNAPDGNGGSGGGAAGGSGGSGTQASGSSTSASSS
FT                   STTGAPVPAGQCADSSLAVKATADKATFAPGEEPSFTIVITNIGSAPCDRDLAGGLQQV
FT                   LVYSIDGKTRLWSNVDCYPQPAADVRNLAPGEQAAFKVAWSATTSTPECATAQNPERNP
FT                   VGAGAYTVVGQLGALRSSPEPFNIA"
     gtgttggaac cgaatggacc actgcccccc gagatctact ggcgtcgccg ggcgctggcc        60
     attggtgccg ccgtcattgc actggcgttg atcatctggg cggcgtccgc cctcttcggc       120
     ggtggaagcg atactcctga ggccaattcg gccgctgcga gttcctcgct gacgacggac       180
     gtctccttca cccccaaccc ttccggctcc aacgcgccgg acggtaacgg tggttcgggt       240
     ggcggtgctg cgggtggatc aggtggctcg ggcacgcagg cttccggatc gtcgacgtcg       300
     gcatcgtcct cgtcgaccac cggcgctccg gtcccggctg gtcagtgcgc ggactcgtcg       360
     ttggcagtca aggcgaccgc agacaaggcg accttcgctc ccggtgaaga gccgtccttc       420
     acgatcgtca tcaccaacat cggttcggca ccctgtgatc gagatctggc gggcggcctg       480
     cagcaggtgc tcgtctacag catcgacggc aagacccgtt tgtggtccaa cgtcgactgc       540
     tatccccagc ccgcagccga cgtacgcaat ctcgctcccg gcgagcaagc tgcgttcaag       600
     gtcgcctggt cggccacgac gtcgaccccc gagtgcgcga ccgcgcagaa ccccgagcgc       660
     aatccggtgg gcgcaggcgc gtacacggtt gtcggtcagc tcggcgcact gcgaagctcc       720
     ccggagccgt tcaacatcgc gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page