(data stored in ACNUC1104 zone)

EMBL: AP008957.PE682

AP008957.PE682       Location/Qualifiers
FT   CDS_pept        complement(761068..762165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31390"
FT                   /db_xref="GOA:C0ZPR2"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR2"
FT                   /protein_id="BAH31390.1"
FT                   /translation="MISAMADTQSSSALRETIARLAPGTALRDGLERILRGRTGALIVL
FT                   GYDEEMEALCDGGFNLDVEFAPTRLRELSKMDGAVVLSTDGTRIVRANVQLVPDHKIPT
FT                   VESGTRHRAAERTAIQTGYPVVSVSQSMSIVSVYVGGIRHVIDGSATILSRANQAVATL
FT                   ERYKARLDEVTRQLSVVEIEDFVTLRDALTVVQRLEMVRRVSIEIEQDVLELGTDGRQL
FT                   ALQLEELVGDNDIARQLIVRDYLAGPEPIGTAAMDNVLVALDRVTDADLLDLTTLARVL
FT                   GYPGTIEALDTPMTPRGYRVLMRVPRLQFHQIHRLVGSFGTLQSLLAATAADLQSVEGI
FT                   GGLWARHIREGLSRLAETSITGSFN"
     atgatcagtg cgatggcgga cacacagtcg tcgtcggcat tgcgagagac catcgccagg        60
     ttggcgccgg gtaccgcttt gcgagacggg ctcgaacgaa ttctgcgcgg acgtaccggc       120
     gcgctgatcg tcctcggata cgacgaggag atggaagcgc tgtgtgacgg cggattcaac       180
     ctcgacgtgg agttcgcacc gacccgattg cgtgagctct cgaagatgga cggcgcggta       240
     gtcctctcga cggacggcac acgcatcgtg cgcgccaatg tccaactggt tcccgatcac       300
     aagattccca ccgtcgaatc cggcaccagg caccgtgccg ccgagcgcac ggcaattcaa       360
     accggctatc ccgtggtctc ggtcagtcag tcgatgtcga tcgtcagtgt gtacgtcggt       420
     ggtatccggc acgtcatcga cggctcggcc accatacttt cgcgcgccaa ccaggccgtc       480
     gcgacgctcg aacgatacaa agcgcgactc gacgaagtga cacggcaact gtcggtggtc       540
     gagatcgagg atttcgtgac tctgcgcgac gcgttgaccg tcgtacagcg actcgaaatg       600
     gttcgccgtg tgtcgatcga aatcgagcag gatgtcctcg agctcggcac cgacggtcgc       660
     cagctggcac tgcagctcga agaactggtc ggcgacaacg acattgcacg tcaactgatc       720
     gttcgggatt accttgccgg ccccgaaccc atcggcaccg cggcgatgga caacgtcctc       780
     gtcgcactcg atcgcgtcac cgacgccgac ctactcgatc tcacgactct tgcgcgtgtc       840
     ctcggttatc cgggcacgat cgaagccctc gacactccga tgactcctcg cggatatcgc       900
     gtactgatgc gtgtgcctcg attgcagttc catcagatcc accggttggt cggatccttc       960
     ggcactctcc agtcgctgct ggccgctacg gctgccgatc tgcagtcggt cgagggcatc      1020
     ggcgggctgt gggcccgtca catacgtgag ggactttccc ggctcgcgga gacgtcgatc      1080
     accggatcgt tcaactag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page