(data stored in ACNUC1104 zone)

EMBL: AP008957.PE683

AP008957.PE683       Location/Qualifiers
FT   CDS_pept        762250..762810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31391"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR3"
FT                   /protein_id="BAH31391.1"
FT                   /translation="MSSTWTLPDDLTVPEPVEFFPAAGEKLPQHWSKCFGCGDDQPAGM
FT                   AMSFRAGDGLEVTGRLEVAKKYQGGPGVIHGGILSTAFDEAQGMACMALGSPVVTGHLE
FT                   IDFARPIPLGSVLEFRARIDGVVRRKVYTSAEAVIVEGPTADPDTVVGTSRGLFLTITS
FT                   EHFAKTKEFVDGEPTSPFGTSSV"
     atgagtagta cctggaccct gcctgatgac ctgactgtcc cggagccggt cgaattcttt        60
     ccggccgccg gcgagaagtt gcctcagcac tggtcgaaat gcttcggctg cggcgacgac       120
     cagcctgcgg gaatggcgat gagtttcagg gctggtgacg ggttggaagt gacgggccgt       180
     ctggaggtcg ccaagaagta tcagggcggt cctggggtca ttcacggcgg cattttgtcg       240
     acggctttcg acgaggcgca aggcatggca tgcatggctc tcggctcgcc ggtggtgacc       300
     gggcacctcg agatcgactt cgcccggccc atcccgttgg gatcggtgct cgaatttcgg       360
     gctcgcatcg acggcgttgt gcgccgcaag gtctacacca gcgcggaagc ggtgatcgtc       420
     gaaggtccga cagcggatcc ggacacggtg gtgggaacgt cccgcggact gttcctgacc       480
     atcacgtcgg aacacttcgc caagaccaag gagttcgtgg acggcgaacc gacttccccg       540
     ttcggcacct cgtcggtctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page