(data stored in ACNUC1104 zone)

EMBL: AP008957.PE686

AP008957.PE686       Location/Qualifiers
FT   CDS_pept        765266..765754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31394"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR6"
FT                   /protein_id="BAH31394.1"
FT                   /translation="MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLT
FT                   VRVPADNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREQDRGLSAGEKRMLAKARQILVGELALAEGTDTEKAETILDEVLAAAS"
     atgattttca aggtcggaga caccgtcgta tacccccatc acggtgcggc gctgatcgaa        60
     gctatcgaaa cccgcaccat caagggtgag cagaaggagt acctggttct gaaggtcgct       120
     caaggcgatc tcacagtacg ggttcctgca gacaacgcag agtacgtcgg agttcgtgac       180
     gtggtcggcc aagaaggcct cgacaaggtt ttccaggttc tgcgagcacc gcacaccgag       240
     gagcccacca actggtctcg tcgatacaag gcaaatctcg agaagcttgc ctcaggtgac       300
     gtgaacaagg ttgcagaagt tgttcgtgac ctgtggcgtc gtgagcagga ccgcgggctt       360
     tccgctggtg agaagcgcat gctcgccaag gctcgtcaga ttctcgtcgg agagctcgcg       420
     ctcgccgagg gcactgacac cgagaaggca gagaccattc tcgacgaggt cctcgcggcc       480
     gcgtcctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page