(data stored in ACNUC1104 zone)

EMBL: AP008957.PE695

AP008957.PE695       Location/Qualifiers
FT   CDS_pept        complement(774943..775665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31403"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS5"
FT                   /protein_id="BAH31403.1"
FT                   /translation="MSRFSMRKTLTGVAIAALATSGLLIGTGAAHADAAHPKTNTVTSN
FT                   QVTITKSVVGDGEVAPGGRLTVRTTVSANGHPDFFVNKFVDRFPAGYTYIKDSASIDSW
FT                   HFLGLTQKTEKVSPTVDNAARTVTIPDAGWNVSITGSKTVTFEVSYLVPDNAQPGTYVE
FT                   LPSSIGISLWGSDQNIGDVYAKIRAKNPGEAAASGSADLGFGSSDGEGGTGSAGSSILD
FT                   NPAGFISDIISGVLANGS"
     atgtcacgtt tctcaatgcg caaaacactc accggagtag caatcgctgc gcttgcaacc        60
     agcggacttc tcatcggcac cggagctgcg cacgcagatg ccgcgcaccc gaagaccaac       120
     accgtgactt cgaaccaagt cacgatcacc aagagcgtcg taggcgacgg agaagtggcg       180
     cccggcggaa gactgaccgt ccgcaccacg gtttcggcca acggccatcc ggacttcttc       240
     gtcaacaagt tcgtcgaccg tttcccggcc ggatacacct atatcaagga cagcgcctcg       300
     atcgattcat ggcactttct cggactgact cagaaaaccg agaaggtctc ccccaccgtc       360
     gacaatgcgg cgcgcaccgt cacaattccc gatgcgggtt ggaatgtctc gatcaccggc       420
     agcaagacag tcactttcga agtgagctac ttggttccgg acaacgcaca gccgggaact       480
     tacgtcgagc tccccagttc catcggcatc tcgctgtggg gcagtgatca gaacatcggc       540
     gatgtctacg ccaagatccg cgccaagaac cccggtgagg ctgccgcatc gggctcggca       600
     gatctgggct tcggctcttc tgacggcgag ggcggaaccg gttcggccgg ctcctccatc       660
     ctcgacaacc cggccggctt catctccgac atcatcagcg gtgtcctggc caacggcagc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page