(data stored in ACNUC1104 zone)

EMBL: AP008957.PE696

AP008957.PE696       Location/Qualifiers
FT   CDS_pept        775975..776682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31404"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS6"
FT                   /protein_id="BAH31404.1"
FT                   /translation="MAKFGSRNRSLSTVGAGLGVIALAVGASALGAGVATAEIATSGAY
FT                   TFTRTVDNASPKVGDTITYTTVSKKSGIDGYISRFTETHAACLTFVPGSAKVTKFHVGG
FT                   TMTETTETPELTATTLEVTSAGWINNGSKPVTMKTSYTVTASCAPGTVYGSGLAVGATV
FT                   MGNGFQSSANFANLGPSITVRAADVVDPVDPVDPVDPVDPVDPTGPGTGGGTGSLGSLS
FT                   GGLGSLGGLFGSS"
     gtggcaaagt ttggatccag gaatcgtagt ctgtccaccg ttggagctgg tttgggggtg        60
     attgctcttg ctgtgggcgc aagcgcgctg ggtgcgggag tcgcgactgc cgagatagca       120
     acttctggtg cctacacatt tactcgcacc gtggacaatg cgtccccgaa ggtcggtgac       180
     acgatcacct acacgacagt gtcgaagaag agcggaatcg acggatatat cagcaggttc       240
     accgagacgc atgccgcatg cttgaccttt gtcccgggct cggcgaaggt cacgaagttt       300
     cacgttggcg ggacgatgac cgaaaccact gaaacgccgg aactgacagc cacgacgctc       360
     gaggtgacca gtgccggctg gatcaacaac ggcagcaaac cggtgaccat gaagaccagt       420
     tacacggtca ctgcttcgtg tgcgccggga accgtgtacg gaagtggatt ggcggtaggt       480
     gccacggtga tgggcaacgg attccagtcg agtgcgaatt tcgccaactt gggcccgtcc       540
     atcactgtcc gcgccgcgga tgtggtcgat cccgttgacc cggttgatcc cgttgatccc       600
     gttgatccgg ttgatcccac tggccctgga accggtggcg gaaccggatc gctcggctcg       660
     ttgagtggtg gcctcggttc cctcggcgga ctgttcggct cgagctag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page