(data stored in ACNUC1104 zone)

EMBL: AP008957.PE702

AP008957.PE702       Location/Qualifiers
FT   CDS_pept        complement(780756..781679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07020"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31410"
FT                   /db_xref="GOA:C0ZPT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT2"
FT                   /protein_id="BAH31410.1"
FT                   /translation="MTETSANTPVPPGNTVPPGNTVPSKASVPAVTLKDARLSFGARTL
FT                   WDGLDLEVQPGEFIAVLGPNGSGKTSLLKILLGQLQLSGGSAQIVGTPARAGNSHVGYI
FT                   PQQKSIDDGLPLRGRDLVGLGVDGHQWGTGLLRRGRRRKIVDDAIAQVSAQSFADAPIG
FT                   SMSGGEQQRLRIAQALVGDPRILLCDEPLLSLDLANQHLVSTLIDKRRRSHDTAVLFVT
FT                   HEINPILPLVDRVLYLVDGKFRIGTPAEVMTSEVLSDLYNTDVEVLQVRGRLVVIGTGD
FT                   AIDALGSAGGLRPGEGVHHSDEDHHQ"
     gtgacagaaa cttccgcgaa tactcctgtg ccccctggta acaccgtgcc tcctggtaac        60
     accgtgcctt cgaaggcctc cgtgcccgct gtgacgctga aggacgctcg attgtctttc       120
     ggcgcccgca cattgtggga cgggctcgat ctcgaggtac agccaggtga gttcatcgcc       180
     gtactcgggc cgaacgggtc gggcaagacc tcgctcctga agattctgct gggccaacta       240
     caactcagcg gcggtagcgc ccagatcgtc ggcacgccgg cacgggccgg gaactcacac       300
     gtcgggtaca tcccgcagca gaaatccatc gacgacggcc tcccgctccg cggccgcgac       360
     ctggtcggcc tcggcgtcga cggtcaccag tggggtacgg gcctactgcg ccgggggcgt       420
     cgccgcaaga tcgtcgacga cgccatcgca caggtcagcg cccagtcgtt tgccgacgct       480
     cccatcggtt ccatgtccgg cggtgagcag cagcgactgc ggatcgcaca ggctttggtc       540
     ggcgacccgc ggatcctgct gtgcgacgag ccgctgctca gcctcgacct cgccaaccag       600
     cacctggtct cgacgctgat cgacaagcgt cggcgcagcc atgacaccgc agtgctgttc       660
     gtgacgcacg agatcaatcc gatcctgccg ttggtcgatc gagtgctcta tctggtggac       720
     ggcaaattcc ggatcgggac gccggccgaa gtgatgacgt ccgaggttct ctcggatctg       780
     tacaacaccg acgtcgaagt gttgcaggtt cgtggccgcc tcgtcgtgat cggcaccgga       840
     gacgccatcg acgcgctcgg cagcgcaggc ggactacgcc cgggagaagg cgttcaccat       900
     tctgatgagg atcaccacca gtga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page