(data stored in ACNUC1104 zone)

EMBL: AP008957.PE71

AP008957.PE71        Location/Qualifiers
FT   CDS_pept        complement(88616..91930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00710"
FT                   /product="probable lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="protein synonym:LysRS"
FT                   /note="protein synonym:lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30779"
FT                   /db_xref="GOA:C0ZL89"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR031553"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZL89"
FT                   /protein_id="BAH30779.1"
FT                   /translation="MESPPENPRQARRFRKGRFSQVPHISGLILGVFSVLVFLWSISPV
FT                   LRHILRVPREYIDSYYFDAPDTSLSWALVVALLAAALASRKRIAWWLLTIYLALITLTN
FT                   IASTIVDKNPNNAVAAVVLLVVIGILIAARPEFYTRVRRGAGWKALGVLIGGMAVATVI
FT                   GWGLVELFPGDLPQNQRFLWALNRVTAAASVDNEVFDGHPRVFVNTVLGLLGAIALLAA
FT                   VMTLFRAQRSNNALTGNDESAIRGLIQNFGADDSLAYFATRRDKAVIFAPSGKAAITYR
FT                   VEIGVCLASGDPIGDPEAWPHAIEAWQDLASQYGWATAVMGASETGATAYKKAGLSVLQ
FT                   LGDEAILRTREFNLNGRDMRPVRQAVTRVRRHGVTVRMRRHRDIPPEDMAAVIIRADDW
FT                   RDTDTERGFSMALGRLGDHLDGDCLLVEAVMGEGTEDESVVGMLSLVPWGPNGVSLDLM
FT                   RRKPTAPNGVVELMVSELATRSDEIGVVRVSLNFAVFRSVFEEGSRIGAGPILRIWRSV
FT                   LVFFSRWWQLEALYRSNVKYQPDWEPRFLCFEDNRELPRVGFASAIAEGFVVLPSFGRK
FT                   SSQVVKHTGTHAAVPAALVTSEGLHADGSPPDSAPSFTTNGPRRPEQVRVRMNKLAQLA
FT                   DEGIAAYPVAYPPTHTIAAAAKSPEGTRVRIAGRLLRVRDYGGVVFTDVRDWSGDIQVL
FT                   VDQDNVGREKLAEFAAEFDLGDLIEVSGTIGRSRKGELSLIAVEWRMNGKCLHPLPDKW
FT                   KGLSDPETRVRQRYLDIALNPKARELLEARSAVVKSLRDSLGGRGYLEVETPILQQVHG
FT                   GANAAPFLTHINAYNLDLYLRIAPELYLKRLCVAGMEKVFEIGRVFRNEGVDFKHNPEF
FT                   TILEAYEAHSDYEGMMRMCRELIQAAAVAAFGREIIMRPGPDGELVEVDISGEWPVKTM
FT                   HGAVAEKLGVDVSPETSLEDLQKLCDANEIPYQSSWDTGAIAQEMYEHLVEDYTEFPTF
FT                   YTNFPTSMSPLTRPHRSIPGVAEKWDLVAWGVELGTAYSELTDPVDQRNRLTEQSMLAA
FT                   GGDPEAMELDEDFLQALEHAMPPTGGLGMGVDRIVMLITGGSIRETLAFPLAKPRQ"
     gtggaatcgc cacccgaaaa tccgcgccag gcgcggcgat tccgcaaagg gcggttcagc        60
     caggttcccc atatctcggg attgatcctc ggagttttct ccgtactggt gttcctgtgg       120
     agcatctcgc cggttctgcg gcacatcctc cgcgtcccac gcgaatacat cgacagctac       180
     tacttcgacg caccggatac gagcctgtcg tgggcgctcg tcgtcgccct gctcgccgcg       240
     gccctcgcga gtcgcaagcg catcgcctgg tggctgctga cgatctacct cgcgctgatc       300
     accctcacca acatcgcctc cacgatcgtc gacaagaacc cgaacaacgc cgtcgccgct       360
     gtcgttttgc ttgtcgtgat cggaatcctc atcgccgcga ggcccgagtt ctacacacgc       420
     gtacgacgcg gcgccggttg gaaagcgctc ggcgtactga tcggcggcat ggctgtcgcg       480
     accgtgatcg gttggggcct tgtcgaactc ttcccgggcg acctgccgca gaaccaacga       540
     ttcctctggg ccctgaaccg cgtcaccgcg gcggcttcgg tcgacaacga ggtgttcgac       600
     ggccacccac gcgtcttcgt caacacggtc ctcggtctcc tcggcgccat cgcactactc       660
     gccgccgtta tgacgctctt ccgcgcgcaa cgctccaaca acgccctcac cggaaacgac       720
     gagtccgcga tccgcgggtt gatccagaac ttcggcgccg acgactccct cgcttacttc       780
     gccacccgcc gcgacaaggc cgtcatcttc gcgccgagcg gcaaggccgc gatcacgtac       840
     cgcgtcgaga tcggcgtctg cctcgccagt ggtgatccca tcggcgatcc cgaggcgtgg       900
     ccgcacgcca tcgaagcgtg gcaggacctg gcctcgcagt acggctgggc gacagccgtc       960
     atgggcgcca gcgaaaccgg ggcgacggcg tacaagaagg caggcttgag cgtcctgcaa      1020
     ctcggcgacg aagcgatcct gcgcacccgc gagttcaacc tcaacggacg cgacatgcgc      1080
     ccggtacgcc aggccgtcac ccgcgtcagg cgccacggcg tcaccgtgcg gatgcgacgc      1140
     catcgcgaca tcccgcccga ggacatggcg gccgtcatca tccgcgcgga cgactggcgt      1200
     gacaccgaca ccgagcgcgg cttctccatg gcgctcggcc gactgggcga tcacctcgac      1260
     ggcgactgcc tcctcgtcga agccgtcatg ggcgaaggca cggaggacga aagcgtcgtc      1320
     ggcatgcttt cgctcgtgcc gtggggaccg aacggcgttt cgctcgacct gatgcgccgt      1380
     aagccgacgg cgcccaacgg tgtcgtcgaa ttgatggtct cggagttggc cacacgttcg      1440
     gacgagatcg gcgtcgtgcg ggtctcgctc aacttcgccg tcttccgctc ggtgttcgag      1500
     gaaggttcgc gcatcggcgc cggcccgatc ctccgcatct ggcgctcggt gctcgtcttc      1560
     ttctcccgct ggtggcagct cgaagcgctg taccgctcga acgtgaagta ccagccggat      1620
     tgggagccgc gttttctctg cttcgaggac aaccgtgagc ttccacgcgt cggattcgcg      1680
     tcggccatcg ccgaaggctt tgtggttctg cccagtttcg gacgcaagtc gagccaggtc      1740
     gtcaagcaca ccggaacaca tgcggcggtg ccggcagctc tggtgacttc cgaaggactg      1800
     cacgccgacg gcagcccgcc ggactcggcg ccgtcgttca cgaccaacgg tccgcgtcga      1860
     cccgagcagg tccgggtgcg catgaacaaa cttgcgcaac tggccgacga aggaatcgcc      1920
     gcctaccccg tcgcctatcc gccgacgcat acgatcgcgg ccgcagcgaa gtcgccggag      1980
     ggcacccgcg tacgcatcgc gggacgcctg ctgagggttc gcgactacgg cggagtcgtg      2040
     ttcacggacg tgcgcgactg gtccggcgac atccaggttc tggtcgacca ggacaacgtc      2100
     ggccgcgaga agttggcgga gttcgctgcc gaattcgatc tcggtgacct gatcgaagtg      2160
     agcggaacca tcgggcgcag ccgcaagggc gagctgtcgc tcatcgccgt cgagtggcgc      2220
     atgaacggca agtgcctgca cccgctgccg gacaagtgga agggcctctc ggatcccgag      2280
     acccgagtcc gccagcggta cctcgacatc gccctcaacc cgaaggcccg cgaactgctc      2340
     gaagctcgaa gtgccgtcgt gaagtcgctt cgcgattcac tcggtggtcg cggatacctc      2400
     gaagtcgaga ccccgatcct gcagcaggtg cacggcggcg cgaacgccgc tccgttcctg      2460
     acacacatca acgcgtacaa cctcgacctc tatctccgca tcgcacccga gctgtacctg      2520
     aagcgcttgt gcgtcgcagg aatggagaag gtgttcgaga tcggccgcgt gttccgtaac      2580
     gagggcgtcg acttcaaaca caatcccgaa ttcacgatcc tcgaggccta cgaggcgcac      2640
     agcgactacg agggcatgat gcggatgtgc cgcgagctca tccaggcggc ggccgtcgca      2700
     gccttcgggc gcgaaatcat catgcgaccc ggcccggacg gcgaattggt cgaggtcgac      2760
     atctccggcg agtggccggt gaagacgatg cacggcgccg tcgccgaaaa gcttggtgtc      2820
     gacgtctccc ccgagacgag tctcgaagac ctgcagaagc tgtgcgacgc caacgagatt      2880
     ccgtaccagt ccagctggga taccggcgcc atcgcgcagg agatgtacga gcacctggtc      2940
     gaggactaca cggagttccc gacgttctac accaacttcc ccacctcgat gtctccgctc      3000
     acccggccgc atcgcagcat ccccggcgtc gccgagaagt gggacctcgt ggcatggggt      3060
     gtcgaactcg gaaccgcgta cagcgagttg accgaccccg tggatcagcg caaccggctc      3120
     accgagcagt cgatgctcgc ggccggcggc gatccagaag cgatggaatt ggacgaggac      3180
     ttccttcaag ccctcgaaca cgcgatgccg ccgacgggtg gtctcgggat gggcgtcgac      3240
     cgaatcgtca tgctgatcac gggcggcagc atccgcgaga cgctggcctt ccccctcgcg      3300
     aaaccgcgtc agtag                                                       3315
//

If you have problems or comments...

PBIL Back to PBIL home page