(data stored in ACNUC1104 zone)

EMBL: AP008957.PE77

AP008957.PE77        Location/Qualifiers
FT   CDS_pept        95801..96964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL95"
FT                   /protein_id="BAH30785.1"
FT                   /translation="MTLSPLDDYPVHQIAETIRHVGTSDRNFYDRYYFNCHAGVDGGTE
FT                   PLFLIIGLGQYPNLGVCDGFAVLRRGDDHIVFRASRALGDDRMDLSVGPLRIEIIEGLH
FT                   RLRVVLDPSPEAPDLSFDLTFESDGPANLEARHFHRQLERVTFDTQRFVQTGTWSGSLT
FT                   VDGDVIPVTPETWRGNRDRSWGVRPVGEAEPPGRKADPSIAGSQNFFWIYSIMQFGDFT
FT                   VVTVVQEDQQGRRILEDATRVWADRSREPEWLGRPDHQLTFISGTREVKSGTLYFRRPG
FT                   APGESDHILEITCEPILPNYIGVGTGYGLEQDWRHGMWQGELVVQGLREKVSDIEPWKK
FT                   MLCPVDNLARFTLVGDGVTRTGTGLFEVAVIGPHQRYGFTGIGDVAP"
     atgacactgt ccccgctcga cgactacccg gtacatcaga tcgccgagac tatccgccac        60
     gtgggcacct cggatcgaaa cttctacgac cgttactact tcaactgcca tgcaggcgtc       120
     gacggcggta ccgagccgct gtttctcatc atcggtctcg gtcagtaccc caatctcggt       180
     gtgtgcgacg gctttgcggt tcttcggcgc ggcgatgacc atatcgtctt ccgggcatcc       240
     cgcgccttgg gcgacgatcg tatggacctg tcagtaggcc cgttgaggat cgagatcatc       300
     gagggtctgc accgtctgcg ggtggtgttg gacccgagtc ccgaagcgcc ggacctgagc       360
     ttcgacctca ccttcgagtc cgacggcccc gccaatctcg aggccagaca tttccatcgc       420
     caactcgaac gagtcacctt cgacacccaa cgattcgtgc aaaccggaac atggtccgga       480
     tccctgaccg tcgacggcga cgtcatcccg gtcaccccgg agacgtggcg gggtaatcgc       540
     gatcgatcct ggggtgttcg accggtcggc gaggcggaac ctcctggacg caaggcggat       600
     ccgtcgattg ccggtagtca gaacttcttc tggatctact cgatcatgca attcggggac       660
     ttcaccgtcg tcacggtcgt tcaagaggat cagcagggac gccgaattct ggaggatgcg       720
     acacgcgtct gggcggatcg ttcgcgcgag ccggagtggt tgggtcgacc ggaccaccag       780
     ctcaccttca tttccggcac ccgcgaggtg aagagcggaa ctctgtactt ccggcgtccc       840
     ggtgcaccag gcgaatccga ccacatcctg gagataacct gcgaaccgat tctgcccaac       900
     tacatcggtg tcggtacggg ctacggactc gagcaggatt ggcgccacgg gatgtggcag       960
     ggagaactgg tggttcaggg cctgcgagag aaggtttcgg acatcgaacc gtggaagaag      1020
     atgctgtgcc cggtcgacaa cttggcccgg ttcacccttg taggagacgg cgtaactcgc      1080
     accgggacag gactgttcga ggtagcagtc attggacccc accagcgata cgggttcacc      1140
     ggaatcggtg atgtcgcacc gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page