(data stored in ACNUC1104 zone)

EMBL: AP008957.PE78

AP008957.PE78        Location/Qualifiers
FT   CDS_pept        97016..97951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00780"
FT                   /product="putative protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="protein synonym:phosphotyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30786"
FT                   /db_xref="GOA:C0ZL96"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL96"
FT                   /protein_id="BAH30786.1"
FT                   /translation="MSTRSRILFARTAKAAALVVTGGLLFAAPATAIPLDLGSLNTGSV
FT                   DLGSLDPVLAPTPNLASVANFRDIAGNDGRGYATVDGSHLKRGVIYRSNALTATSDADK
FT                   ATLTGLGLADAYDLRGSTEISNPFIGGADKLPDGVTYTNIPIEFKDLTQLATTIKSPEE
FT                   AKQFLVDTNRSFVTDPVRRAGFKQVLSDIAAGDGVQLFHCTSGKDRTGWTAMLLQTIAG
FT                   VPAQTIMDDYLLSNTYLQATNEKILAQISQALSPQVATNLEPALGVDASYLEAGLAQIA
FT                   SDYGTVDGYLTEGLGLTADTIALLKAKLVD"
     atgtccacac gctcacgaat attgttcgct cgcactgcga aggccgccgc acttgttgtc        60
     accggaggcc tgttgtttgc cgctcccgcc acggccatcc cgctcgactt gggctctctc       120
     aacacgggat cggtcgatct cggctcgctc gatcctgtgc tcgcgccgac accgaacttg       180
     gcctccgtgg ccaactttcg cgacatcgcc ggtaatgacg gtaggggata cgccaccgtc       240
     gacggctcgc acctcaagcg cggcgtcatc taccggtcca atgcgctgac cgcgaccagc       300
     gacgcagaca aggcgacgct caccggcctc ggacttgccg acgcctatga cctgcgcggt       360
     tcaaccgaga tctccaaccc gttcatcggt ggcgcggaca agctcccgga cggtgtgacg       420
     tacacgaaca tccccatcga gttcaaggat ctcactcagc tcgccacaac gatcaagtcg       480
     ccggaagagg ccaagcagtt cttggtcgac accaaccgca gttttgtcac cgatcccgtg       540
     cgccgcgccg gcttcaagca ggtgctctcg gacatcgctg ctggtgacgg ggtgcagttg       600
     ttccattgca cttcaggcaa ggaccgcacg ggttggaccg cgatgttgct gcagaccatc       660
     gctggtgtcc ccgcccagac gatcatggac gactatctgt tgagcaacac ctaccttcag       720
     gcgaccaacg agaagatcct tgcgcagatc tctcaggctt tgagcccgca ggtagcgacc       780
     aatctcgagc cagccctcgg tgtcgatgcg tcgtacctgg aagctggact cgcgcagata       840
     gccagcgatt acggaaccgt cgacggttat ctcaccgaag gtctcggact cactgcggac       900
     acgatcgcac ttctgaaggc caagctcgtc gactag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page