(data stored in ACNUC1104 zone)

EMBL: AP008957.PE81

AP008957.PE81        Location/Qualifiers
FT   CDS_pept        complement(99335..100309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30789"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL99"
FT                   /protein_id="BAH30789.1"
FT                   /translation="MLSELQSVVQLTPTSAARRPVPGSVQMKRYDLRSRTDRLDPETDY
FT                   EEMSRILAAQEFPWDINQALSFALFRTYAVPSIGKLLFSTGEFTDKVQKRYDDTSLILD
FT                   AILEHGLSSTEGRKSVRRMNQMHGSYDISNEDMLYVLATFVVTPVRWLDEYGWRKMTDN
FT                   EIVGSTNYYRHLGRYMNIKDTPDTYEGFVKLLDDYEREHFSFDSGARAVADSTLDLMCT
FT                   FSPNNLAPKALVKGFAFALMDDHLLDAFHYKHPSTAMRVVSRGALKVRARLLRFFPVRT
FT                   KRKFARELPNIRSYPNGYKVEDLGTFPTGCPVKHLQADQQAQA"
     gtgttgtcag aactacagtc ggtggtgcag ctcacaccta cctctgcagc gcgcagacca        60
     gtcccaggga gtgttcagat gaagcgctac gacctccgca gtcgcacgga tcgactcgat       120
     cccgaaaccg attacgaaga gatgtcgcgc attctcgcgg cgcaagagtt tccctgggac       180
     atcaatcagg cgctcagctt cgcccttttt cgcacgtacg cggtcccttc catcggcaaa       240
     ctcctcttct cgacgggcga gttcaccgac aaggttcaaa agcgctacga cgacaccagc       300
     ctgatcctcg acgccatcct cgagcacggc ctcagcagca ccgaaggccg caagagcgtg       360
     cgtcgtatga atcagatgca cggttcttac gacatctcca acgaggacat gctctacgtt       420
     ctggccacct ttgtcgtcac gccggtcaga tggctcgacg agtacggctg gcggaagatg       480
     accgacaacg agatcgtcgg gtcgacgaac tattaccgcc acctgggtcg gtacatgaac       540
     atcaaggaca ctcctgacac ctacgagggg ttcgtcaaac ttctcgacga ctatgagcgc       600
     gaacactttt cattcgactc cggagcgcgg gccgtcgctg attccaccct cgacctgatg       660
     tgcaccttct cgcccaacaa cctggcgccg aaggctctgg tcaagggatt cgcgttcgcc       720
     ctcatggacg atcacctact cgacgccttc cactacaagc acccgagcac cgcgatgcgc       780
     gtcgtctcgc gcggtgcgct gaaggtccgt gcgcgtctgc tgcgcttctt cccggtgcgt       840
     acgaagcgga aattcgcccg cgagctgccc aacatccgca gctacccgaa cggttacaag       900
     gtcgaagacc tcggcacctt ccccacggga tgcccggtca agcacctgca ggcagaccag       960
     caggcccaag cgtag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page