(data stored in ACNUC1104 zone)

EMBL: AP008957.PE82

AP008957.PE82        Location/Qualifiers
FT   CDS_pept        100402..100860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30790"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA0"
FT                   /protein_id="BAH30790.1"
FT                   /translation="MSVTRTAGVFAAIGLPIAASVMFAGVASADPPHPFGGAAVTIGCP
FT                   NQGSLASLTGLTGQSGPESNPPIAKGDIRFDSFPAAAPIPAAGQVTVAWVNTDTGKSGI
FT                   VDLVGAYPYLSATVNTGVGNVVATAFGSINWGSSPICQSNPTIGRFIA"
     atgagcgtca cacgcacggc cggggttttt gcggccatcg gattaccgat tgccgcgagc        60
     gtcatgttcg ccggagtcgc ctcggctgat ccgccccacc ctttcggcgg cgccgccgtc       120
     acaatcgggt gcccgaatca ggggtcactg gcctcgttga ccgggctcac cggccagtcc       180
     ggaccagagt ccaatccgcc catcgccaag ggtgatattc gcttcgattc gttcccggca       240
     gctgcgccca ttccggcggc gggtcaggtg accgttgcgt gggtcaacac cgacacgggt       300
     aagtccggaa tcgtcgacct ggtaggggcg tacccgtatc tctctgccac ggtgaatacc       360
     ggcgtcggca atgtcgttgc gacggcgttc ggttcgatca attggggcag tagtcccatc       420
     tgccagtcga atccgacgat cggcaggttc atagcctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page