(data stored in ACNUC1104 zone)

EMBL: AP008957.PE88

AP008957.PE88        Location/Qualifiers
FT   CDS_pept        106859..108586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30796"
FT                   /db_xref="GOA:C0ZLA6"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA6"
FT                   /protein_id="BAH30796.1"
FT                   /translation="MLGRYPYRDSSKERNPMSSNLSHKAYMIGAGIGNLSAAVYLIRDG
FT                   EWNGEDITIMGLDMHGANDGESAATFQHQYGHRELGNDAGFINRGGRMLNEETYENLWD
FT                   ILSAVPSLDNPGKSVTDDILDFDHAHPTHDVARLIDRDGIRNKGENDYKHMQFDNKDRY
FT                   LLTKLMTMPESDEAKLDDISIEQWFEDTPHFFTTNFWYMWETTFAFKRVSSAMELRRYM
FT                   NRMILEFSRIQTLAGVTRSPYNQYESIILPMRTFLEGKGVKFVNELKITEFVFKDTPLR
FT                   DEIIVTGLDYENVRTGEKGRIDVAEGDFVFDTNGSITDSSSIGDLDTPIVEDMRYAPSA
FT                   LLWKQATEHFYDLGNPDKFFGDRAQSEWTSFTVTTSSHELINEISRITKQLPGNALNTF
FT                   VDSNVLLSIVVHHQPHYHAQKENEGVFWGYCLFPRKDGDYVKKPFIEMTGREMLEETLG
FT                   HLEALDESGALAARRQEIMDSVVNSIPSHMPYASALFNRRAVGDRPLVVPKHSKNLAFI
FT                   SQFAELPFDMVFTEQYSVRCAQVAVYKFLGIPEDKLTKMHHYEKDPKVLAKAAVTMFR"
     atgcttggaa ggtatccgta ccgcgactcg agtaaggaac gaaacccaat gtcttccaat        60
     ctgtctcaca aggcctacat gatcggtgcc ggcatcggaa acctctcggc tgccgtctat       120
     ctgattcgag acggtgagtg gaacggtgag gacatcacca tcatgggcct ggacatgcac       180
     ggagcgaacg acggcgaatc cgccgctacg tttcagcacc agtacggcca tcgcgaactc       240
     ggtaacgacg cgggtttcat caaccgcggc ggccgcatgc tcaacgagga aacctacgag       300
     aacctctggg acatattgag tgcggttccg tcgctggaca acccgggaaa gtcggtgacg       360
     gatgacattc tcgacttcga ccacgcgcac cccacgcatg acgtcgcacg gttgatcgac       420
     cgagacggta ttcgcaacaa gggcgagaac gattacaagc acatgcaatt cgacaacaag       480
     gaccggtact tgttgacgaa gctgatgacg atgccggagt cggacgaggc aaaactcgac       540
     gacatcagca tcgagcagtg gttcgaggac actccgcact tcttcaccac caacttctgg       600
     tacatgtggg agaccacttt cgctttcaag cgggtgagtt cggcgatgga gcttcgccgg       660
     tacatgaacc gaatgattct cgagttcagc cgcattcaga cgcttgcggg tgtcaccagg       720
     tccccgtaca accagtacga gagcatcatc ttgccgatgc ggaccttcct cgaaggtaag       780
     ggcgtgaagt tcgtcaacga actgaagatc acggagttcg tgttcaagga caccccgctt       840
     cgagacgaga tcatcgtgac gggactcgat tacgagaacg tccgcaccgg cgagaagggc       900
     cgaatcgacg tggcggaagg cgatttcgtc ttcgacacca acggcagcat caccgacagt       960
     tcgtcgatcg gcgatctcga caccccgatc gtcgaagaca tgagatacgc gccgagtgcg      1020
     ctgctgtgga agcaggccac cgagcatttc tacgatctcg ggaatcccga caagttcttc      1080
     ggggaccggg cgcagagtga gtggaccagc ttcaccgtca ccacttcgtc acacgagctc      1140
     atcaacgaga tttcccgaat caccaagcag ctccccggaa atgcactcaa cacgttcgtg      1200
     gactcgaacg tgcttctgtc gatcgtggtt caccatcagc cgcactacca cgcgcagaag      1260
     gagaacgaag gagtcttctg gggttactgt ttgttcccgc gcaaggacgg cgactacgtg      1320
     aagaagccgt tcatcgagat gaccggccgg gaaatgctgg aagagactct cgggcatctc      1380
     gaggcactcg acgagagcgg tgcgctcgcc gcgcgccgac aagagattat ggacagcgtc      1440
     gtgaattcga ttcccagcca catgccttac gccagtgcgc tgttcaatcg gcgagccgtc      1500
     ggcgaccggc cgctggtggt gccgaagcac tccaagaacc tggccttcat cagtcagttc      1560
     gcggagttgc cgttcgacat ggtgttcaca gagcagtact cggtgcgctg cgctcaggtg      1620
     gccgtctaca agttcctggg gattccggaa gacaagctca ccaagatgca tcactacgag      1680
     aaggatccga aggtcctcgc caaggccgca gtgacgatgt tccgctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page