(data stored in ACNUC1104 zone)

EMBL: AP008957.PE89

AP008957.PE89        Location/Qualifiers
FT   CDS_pept        complement(108594..108971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30797"
FT                   /db_xref="GOA:C0ZLA7"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA7"
FT                   /protein_id="BAH30797.1"
FT                   /translation="MAEQTRPNFPQYCGYLLGKTLPDRYQDWVRNDLVGPGAQARYIIR
FT                   FTVPATLILLLFLLIPGPIWIPLAMMALLLIPLAYFVVALGTIYRRHRLLSHGLDPELL
FT                   DEKAQRRADRTREDYEKRHGR"
     atggccgaac agactcgccc gaactttccc cagtactgcg gatacctcct ggggaagacg        60
     ctccccgacc ggtaccagga ctgggtgcgg aacgatctgg tcggaccggg tgcgcaggct       120
     cgctacatca ttcgtttcac cgtgccggcg acgctgattc ttctgctgtt cctgttgatt       180
     ccgggaccga tctggattcc cttggccatg atggctttgc tgctcatccc gctcgcgtac       240
     ttcgtcgtgg cgctcgggac catctaccgc cgtcaccgcc tgctgagcca cggactcgat       300
     cccgaactgc tcgacgagaa ggcccagcgc cgtgccgatc gcactcgcga ggactacgag       360
     aagcggcacg gtcgctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page