(data stored in ACNUC1104 zone)

EMBL: AP008957.PE95

AP008957.PE95        Location/Qualifiers
FT   CDS_pept        114481..114855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30803"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB3"
FT                   /protein_id="BAH30803.1"
FT                   /translation="MRELFSGPLRSIYCRYIVDTSKKHRQSRRTTCTPHTTTQKCKNVA
FT                   SMAAEARIVDTVSVEDSMESAPRVASKTEQKDALKADAVAKVSADLVDPTSVDTAVLTS
FT                   VKPAQRSVLRWVYSEVPLSR"
     gtgcgggaat tattctccgg acccttgcgt tcgatctatt gtcgatatat cgtcgatacg        60
     tcaaagaaac acagacagtc caggaggaca acatgtacgc cccacacaac aacccagaaa       120
     tgcaagaacg tcgcgagcat ggccgccgag gcccgcatcg tggacacggt ttccgtcgag       180
     gattcgatgg agagcgcccc gagggtcgct tcgaagaccg agcagaagga cgccctgaag       240
     gccgacgcgg tcgcgaaggt cagcgcggat ttggtcgacc cgaccagcgt ggacacggcc       300
     gtcctcactt cggtgaagcc ggcgcagcgc tccgtcctgc gatgggtcta ctccgaggtg       360
     ccgctgtcgc ggtag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page