(data stored in ACNUC1104 zone)

EMBL: AP008957.PE97

AP008957.PE97        Location/Qualifiers
FT   CDS_pept        complement(115971..117209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30805"
FT                   /db_xref="GOA:C0ZLB5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB5"
FT                   /protein_id="BAH30805.1"
FT                   /translation="MDSREAWQLDGEDLKSEVLDLVRARHELQSRMVLLIVEMFSREVL
FT                   GGKGFRAIAQWLHGSTNLEIGECSLLVGLARLLMLEPVVADAFHRGDVDALKARQVASF
FT                   CQHPPKNMTLADVDKARGILLGLASKNIADCDAVRAAIRRIEKQYGKREDGVPVGEDSE
FT                   RNEFYASKGLYGRVTVKGDLDAVNGARLITLLSRLSAPTPEKDGVKDTRTPALRRADGF
FT                   CELLRRYERAGLGPIEGGVKPHITVTASAKDMTDLQALKDLLPSTEELGFAWTDWVGPI
FT                   SIDTARMLACDCTVTRILLDENGVPLECGKEARTATVPQRRALAVRDGGCAFPGCGTPS
FT                   GWCDAHHIVHWNDGGPTDLDNLILLCGHHHRTLHHTEWRVEIGPDRKTVFYPPMSIDPY
FT                   QQPIGGNSPPTAA"
     atggacagtc gggaagcgtg gcagctggat ggtgaggacc tcaagagtga ggttctcgat        60
     ctggtgcgcg cccggcacga gttgcagtcg cggatggtgt tgttgatcgt ggaaatgttt       120
     tcccgtgagg ttctcggggg gaagggtttt cgggcgatcg cgcagtggtt gcatggttcg       180
     acgaatttgg agatcggtga gtgcagtctg ctggtcgggt tggcgcggtt gttgatgctc       240
     gaacctgttg tggcggatgc gtttcaccgc ggtgatgttg atgcgttgaa agcccgtcag       300
     gtggcgtcgt tttgtcagca tccgcccaag aacatgaccc tggcagatgt ggacaaggct       360
     cgcggaattc tgctcgggtt ggcgtcgaag aacattgccg attgtgatgc agtgcgggca       420
     gcgattcggc ggatcgagaa gcagtacggc aagcgtgagg acggcgtccc ggtcggggaa       480
     gattccgaac gtaacgagtt ctacgcctcg aaaggcttgt acggcagagt gactgtgaag       540
     ggcgatttag atgctgtgaa cggggcccgt ctgatcacct tgttgtcgag gctgtcggcg       600
     ccgacaccgg agaaggacgg cgtcaaggac acccgcacgc cggcattacg gcgggcggac       660
     gggttttgcg aactactacg ccggtacgag cgagcggggt tgggcccgat cgaaggcggc       720
     gtgaaaccac acatcacggt caccgcgtcc gcaaaagaca tgacggacct gcaagcgttg       780
     aaagacctcc tgccgtccac tgaggaactg gggttcgcgt ggacggattg ggtgggcccg       840
     atcagtatcg atactgcgcg gatgctggcg tgcgactgca cggtcacgcg gattttgttg       900
     gatgagaatg gtgttccgct cgagtgcggt aaggaagcga gaacggcgac ggtgccgcag       960
     cggcgggcgt tggcagttcg ggatggtggg tgcgcgttcc cagggtgcgg gactccgtcg      1020
     gggtggtgcg atgctcatca tattgttcac tggaacgatg gtggcccaac ggatctcgac      1080
     aatctgattc tgttgtgcgg tcatcaccac cggacactgc accacaccga gtggcgtgtc      1140
     gagatcggcc ccgatcggaa gacggtgttc tatccgccga tgtcgatcga tccgtatcag      1200
     cagccgatcg gcggaaacag cccaccgaca gccgcctga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page