(data stored in ACNUC1104 zone)

EMBL: AP008957.PE99

AP008957.PE99        Location/Qualifiers
FT   CDS_pept        complement(117916..119118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00990"
FT                   /product="probable two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30807"
FT                   /db_xref="GOA:C0ZLB7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB7"
FT                   /protein_id="BAH30807.1"
FT                   /translation="MDEPGPNLAKLGEMHRSPLTPVFAGLQLGLHVLVMALAGVVFLRA
FT                   LIDESDLTATIIALAVIFVAVYLFGVAKRLRGNAARWWLAVLTLVWIATMAVSADAAYL
FT                   AFGLFFLYLHILRRPWSLLAVTAATAVAVIGTGLHRGWTVAGAVGPIIGAAVAVAIGLG
FT                   YQALYREAAERGRLIDELMNTREELASTSRDAGKFAERERLAAEIHDTVAQGLSSIQML
FT                   LHAAERADPESPAIRQISLARETAADSLAETRQLIAELTPAALDGQSLADALRRICERA
FT                   SSPELEARSVVEGEALRLPMPLEATLVRIAQGAVSNVLRHADATRMAVTLTYSDNTVSL
FT                   DVVDNGRGFDVAVLERGPAESFGLNAIRRRVELQGGTFSIESEPGHTAVAVTFPLDVGE
FT                   Q"
     atggatgaac caggcccgaa cctcgctaag ctgggcgaga tgcaccgatc tccgctcacg        60
     cctgtcttcg ccggcctaca actgggcctg catgtccttg tcatggcgct ggccggtgtg       120
     gtgtttcttc gagcgctgat cgacgaatcc gacctgaccg caacaatcat cgcgttggcc       180
     gtgatctttg ttgccgtcta tcttttcggg gttgccaaaa ggctgcgcgg caacgctgcc       240
     cgctggtggc tggccgtgct gaccctcgtc tggatcgcga cgatggcggt atccgccgac       300
     gccgcctacc tcgcgttcgg actcttcttc ctctatctcc atattctgcg gcgcccgtgg       360
     agcctgctgg ccgtcaccgc ggcaacggct gtcgccgtga tcggcaccgg attgcatcgc       420
     gggtggacgg tggccggcgc cgtcggcccg atcatcggcg ccgccgtagc cgttgctatc       480
     ggtctcggat atcaagcgct gtaccgcgag gcagccgagc gcggacgtct catcgacgaa       540
     ttgatgaaca cccgtgaaga attggcgtcg acgtctcgcg atgccggaaa attcgccgaa       600
     cgtgaaaggc tcgcagccga gatccacgac accgtggccc aaggactttc gagcatccag       660
     atgctccttc acgctgccga acgcgccgat ccggagagcc cggccatccg gcagatcagc       720
     ctcgcacggg aaactgcagc ggacagtctt gccgaaaccc gccaactcat cgccgaattg       780
     acaccggcgg ccctggacgg tcagtcgctc gccgatgcgc ttcgtcgaat ctgtgaacgc       840
     gcgagcagtc ctgaactgga agcacgatcc gtggtcgaag gtgaggcact acggctgccg       900
     atgcccctcg aagcaacact ggtgcgcatc gcccagggtg cggtgtccaa tgttctccgc       960
     cacgcggatg caaccagaat ggctgtgaca ctgacgtatt ccgacaacac cgtcagcctc      1020
     gacgtggtcg acaacggccg cggcttcgac gtggcagttc tcgaacgtgg accggcggaa      1080
     tcttttggcc tcaatgcaat tcgacgacgc gtcgaactgc agggcggaac gttctcaatc      1140
     gagtcggagc cgggacacac ggccgtcgcg gtgacgtttc ccctcgatgt cggtgaacag      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page