(data stored in ACNUC1104 zone)

EMBL: AP008957.PKNA

AP008957.PKNA        Location/Qualifiers
FT   CDS_pept        complement(34073..35431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="RER_00290"
FT                   /product="probable serine/threonine protein kinase PknA"
FT                   /EC_number="2.7.11.1"
FT                   /note="protein synonym:protein kinase A"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30737"
FT                   /db_xref="GOA:C0ZLG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG9"
FT                   /protein_id="BAH30737.1"
FT                   /translation="MALNNGALIADRYRLIRLIATGGMGQVWEATDSRLNRRVAVKVLK
FT                   SEFSSDPEFLERFRFEARTTAQLNHPGIAGIYDYGETRDSSGDSTAYLVMELVNGEPLN
FT                   AVLARVGRLAVPHALDMLEQTGRALQVAHDAGVVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVENSPVTRTGMVMGTAQYIAPEQALGQDATAASDVYSLGIVGYEALSGRRPFTGDGA
FT                   LTVAMKHVQETPAPMPADLPANIRELIDITLTKDPAGRYASGGEFADAVAAVRAGRRPP
FT                   PPGLLATGAASALPATGATQVMPPTYAGPVTGAAVADDAAAGGMTSGQKAVAWAGGGLI
FT                   LLALIIGGVWIATDGPSDPTPPVVTSTTLPTTTTTKPTTTTTRPTTTTTEPTTTTTRPT
FT                   TTTTEPTTTTTTPTTTTTTPTTTTTTTTTTTTTTTTEPLADPGDAEEPLGQDQ"
     gtggcgttga acaacggcgc tttgatcgcc gatcgttacc gattgatccg tctcatcgcc        60
     accggtggga tgggtcaggt gtgggaagcc acggactccc ggctcaaccg tcgcgtcgcc       120
     gtcaaggtac tcaagtccga gttctcttcc gatccggagt tcttggagcg cttccgcttc       180
     gaggcccgca ccaccgcaca gctcaaccat cccggtatcg ccggaatcta cgactacggc       240
     gagacccgcg acagctcggg tgattccacg gcgtacctgg tgatggaact cgtcaacggt       300
     gaaccgctca acgctgtcct ggcacgcgtc ggccgcctgg cggttccgca tgccctcgac       360
     atgctcgagc agaccggccg cgccctgcag gtcgcacatg acgccggtgt cgtgcaccgc       420
     gacgtgaagc cgggcaacat cctcatcacg ccgacgggcc aggtgaagat cacggacttc       480
     ggcatcgcca aggccgtcga gaactcgccc gtcacgcgta cgggaatggt gatgggcacc       540
     gcccagtaca tcgcgcccga gcaggctctc ggtcaggacg cgaccgcggc gagtgacgtg       600
     tactcgctgg gaatcgtcgg atacgaagca ctttcgggtc gacgcccgtt caccggtgac       660
     ggcgcgctca ccgtcgcgat gaagcacgtg caggaaaccc cggcgccgat gccggccgac       720
     ctgccggcga acatccgcga gctcatcgac atcacgttga ccaaggatcc ggccggccgc       780
     tacgccagtg gcggtgagtt cgccgacgcc gttgcagccg ttcgggcagg gaggcgtcca       840
     ccgccgcccg gtctgctcgc caccggtgcc gcgagcgcgt tgccggctac gggtgccact       900
     caggtcatgc cgccgacgta cgcgggcccg gtgacgggcg cagctgttgc ggacgacgcg       960
     gcagccggcg gaatgaccag tgggcagaag gccgtggcat gggccggcgg cgggttgatc      1020
     ttgttggcgt tgatcatcgg cggagtctgg atcgcgaccg acggtccgag cgacccgacg      1080
     ccgcccgtcg tcacgtccac gacgttgccg accaccacga ccaccaagcc caccaccacg      1140
     acgactcggc cgacgacgac gaccaccgag ccgacaacaa cgacgactcg gccgacgaca      1200
     accacgaccg agccgacaac caccacgaca acgccgacca cgacaacaac aactccgacg      1260
     accacaacca ccaccacgac gacaacgacg accacaacga ccactgagcc gttggcggat      1320
     cccggagacg ctgaagaacc gctaggacaa gaccaatga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page