(data stored in ACNUC1104 zone)

EMBL: AP008957.PKS13

AP008957.PKS13       Location/Qualifiers
FT   CDS_pept        253553..258496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pks13"
FT                   /locus_tag="RER_02210"
FT                   /product="probable polyketide synthase Pks13"
FT                   /note="protein synonym:type I polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30929"
FT                   /db_xref="GOA:C0ZLV2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLV2"
FT                   /protein_id="BAH30929.1"
FT                   /translation="MVEQDGVQSKDVVSEMSVAQLREWLRNWIADATGQPVSTIVDDRP
FT                   LDEFGLASRDAVALSGDIEDLLGVTLTATIVYQHPTIASLATRIIEGEPEAPEETVDAS
FT                   YYVSGATTDAHDIAIVGLSTRFPGAGHTPSDMWEMLAAGRDGISDLPEDRWAEFMSDPA
FT                   IKAAVENANTKGGYLDDVKGFDAEFFAMSPLEVVNVDPQQRLALELAWEALEHARIPAS
FT                   GLKGKQVGVFIGSSANDYQLLAVSDPTTAHPYALTGTSTAIVANRVSYFFDFRGPSIAL
FT                   DTACSSSLVAVHEAVRSLRSGDSNIALAGGVNMLLAPPGTLGFDQTGMLAPDGKLRAFS
FT                   AHAQGIVRSEGGGLVVLKRLEDAERDGDSILAVIAGSAVNQDGRSNGLLAPNPDAQADV
FT                   LRFAYRDAGIVPTTVDYIEAHGTGTDLGDPIEADALSRVVGRGRDDDKPALLGSAKTNF
FT                   GHLEAAAGAAGLIKVVLAMQENKIPATINYLGPNPHIDFEKAHLQVTPEATDWPRYTGK
FT                   AVAGVSGFGFGGTNAHVVVKEYVPADVAVDEPVVDAPVADEPAAEDESTVVLAVSGALP
FT                   SRRRRAAADLADWLETEEGSKTPLADVARTLARRNHGRSRAAVLAKTRSEAISSLRAVA
FT                   AGKPAQGVFSADSPSPKGAVWVFSGFGSQHRKMAKQLYTENAAFKAAVDEVDALIQDEA
FT                   GYSMVEMFLDDAIEYNVETAQVGIFTIQVGLAALLRHHGAEAEAVVPHSMGEAAAAYVS
FT                   GGLNLEDAVRVICSRSRLMGEAEGALVGDDIRLMALLEYSASEIEALLPTYPKLEVCVY
FT                   AAPTHTVIGGPQPDIEAIVAAAEADGKMARVLQTKGASHTSQVDPLLGELAAELAGIEP
FT                   TTLKLGVYSSVDKDTFYRPGHEPIHQEAYWVKGLRHSVYFTNAVRGAVAHGHTTFVELA
FT                   PNPVTLMSVAATAFDSGLHDMELIQTLKRKEDESAGVLAALAQLYVHGHAVNLESLLPA
FT                   GDFASVPRTAFLRKPYWLDIRVSAGGSARVPGSHVALPDGRHVWEVDASAVTDLAVLVS
FT                   AAAGQVLSDVALTAAVPHGELAGAATLTTTLNPHPGGASVQVHAREGSTFRLLFDAVVT
FT                   SGEPLPELVISAPVKTSAPMETLAEVVEDAGDKWDPNGSQSLDDRLKIVVAESMGYSPE
FT                   DLPAEVPLIELGLDSLMAMRIKNRVEYEFDIPQLQLQAVKDASLNEVNKYLRYAIDNRE
FT                   EVQAMADKQAAEKLAADAADEDAAPAEESVELPATAPVAAAPSDPSRAGTADDAGSDVP
FT                   PRDAAERLTFATWAVVTGKSAKGIFNDLPIVGDEVAEKLAARLSERAGGEITLDDVLDS
FT                   TTIEELADVVRQYLEDDGKIDGLVRTLRARPEGSTAVPVFVFHAAGGSTVTYEPLLKRL
FT                   PAGTPMYGFERVEGSIETRAAAYVPLLREIQGDGPYVLCGWSFGGVMSYAVAKLLREQG
FT                   ADVRVVGLLDTVMAGEVVPDTEAERRKRWERYGKFAKRTYNLDVPLPLDVLASTEADED
FT                   QIQILMDMIKMSGAKIPGGIIEHQRTSWLDNRAIQTAEFSSYDGDVVLYMADKYHDELM
FT                   TLEPAFKTRKADGGWGDYVKNLEVVYIGGDHLQIVDEPYIAKVAADLTTKLAQIETAQT
FT                   KAAETGVQK"
     atggttgaac aagatggtgt gcagagcaaa gacgttgtga gcgagatgag tgtcgcgcag        60
     ttgcgtgagt ggcttcgcaa ctggatcgcc gacgcgaccg gtcagccggt gtcgacgatt       120
     gtggacgacc ggccgctgga cgagttcgga ctcgcctcgc gggacgcagt tgctctgagc       180
     ggagacatcg aggatctgct cggtgtcacg ctgaccgcca cgatcgtcta ccaacacccc       240
     accatcgcct cgctggctac tcggatcatc gaaggtgagc ccgaggcgcc ggaggagacc       300
     gtcgacgcgt cgtactacgt ctcaggcgcc acgacggacg cccacgacat cgccatcgtc       360
     ggactgtcca cacgattccc cggtgccggg cacacgcctt cggacatgtg ggaaatgctg       420
     gcggccggac gcgacggcat cagcgacctc cccgaggacc gctgggccga gttcatgtcg       480
     gatcccgcca tcaaggccgc ggtcgagaac gccaacacca agggcgggta cctcgacgac       540
     gtcaagggct tcgacgccga gttcttcgcg atgtctccgc tcgaggtcgt caacgtcgat       600
     ccgcagcagc gcctcgccct ggaactcgcg tgggaagcgc tcgagcatgc gcgcattccg       660
     gccagcgggc tcaagggcaa gcaggtcggt gttttcatcg gcagttccgc caacgattac       720
     cagttgctcg cggtcagtga tccgacgacg gcgcacccgt acgcactgac cggaacgtcg       780
     acggccatcg tcgcgaaccg ggtttcgtac ttcttcgact tccgtggacc gtccatcgct       840
     ctggacaccg cgtgctcgtc ttcgctggtt gccgttcacg aggctgtgcg ttcgctgcgc       900
     agtggtgatt ccaacatcgc gctggccggt ggcgtcaaca tgctgctggc ccctcccgga       960
     accctcggtt tcgatcagac cgggatgctc gctcccgacg gaaaactgcg tgcattttcc      1020
     gcacacgctc agggcatcgt tcgcagtgag ggtggcggac tcgtcgtgct caagcgtctc      1080
     gaagacgccg agcgtgacgg cgattccatc ctcgcggtga tcgccggatc cgcggtcaac      1140
     caggacggcc gttccaacgg tctgctcgcg cccaacccgg acgcccaggc cgacgtgttg      1200
     cgtttcgcgt accgcgacgc cggcatcgtg ccgaccacag tcgactacat cgaggcgcac      1260
     ggaacgggca ccgatctcgg tgatcccatc gaggccgacg cgctcagtcg tgtcgtcggt      1320
     cgtggccgtg acgacgacaa gccagctctg ctcggtagtg cgaagaccaa cttcgggcac      1380
     ctggaagcag ctgcgggcgc tgccggcctg atcaaggtcg ttctggcgat gcaggaaaac      1440
     aagattcccg cgacgatcaa ctacctgggc ccgaacccgc acatcgactt cgagaaggcg      1500
     cacctgcagg tgacgcccga ggccaccgac tggccgcgct acaccggcaa ggccgtcgcc      1560
     ggcgtttccg gtttcggttt cggcggaacc aacgcgcacg tcgtggtcaa ggaatacgtg      1620
     cctgccgacg tggcagtcga tgaaccagtc gtggatgccc cggtagctga cgaaccggca      1680
     gcagaggacg agagcaccgt tgtgctggct gtgtccggtg cgctgccttc gcgtcgtcgc      1740
     cgcgcagctg cagatctggc cgactggctc gaaaccgaag agggaagcaa gacgcccctc      1800
     gccgacgtcg cccgcacact cgcgcgtcgc aaccacggac gctcgcgcgc cgctgttctg      1860
     gcgaagacgc ggtccgaggc catcagctcg ctgcgcgccg tcgccgcagg caagccggct      1920
     caaggagtct tctcggccga ctcgccgtcg cccaagggcg cggtgtgggt gttctcgggc      1980
     ttcggctcgc agcaccgcaa gatggccaag cagctctaca cggagaacgc ggctttcaag      2040
     gcagccgtcg acgaggtcga tgcgctgatc caggacgagg ccggctactc gatggtcgag      2100
     atgttcctcg acgatgcgat cgagtacaac gtcgagaccg cacaggtggg aatcttcacc      2160
     atccaggtcg gtctggccgc attgctgcgt caccacggcg ctgaagccga agccgtggtt      2220
     ccgcactcga tgggtgaggc cgctgccgca tacgtgtccg gtggtctgaa cttagaagac      2280
     gctgtgcgcg tgatctgttc acgttcacgg ctgatgggtg aggccgaggg cgcactcgtc      2340
     ggcgacgaca tccgtctgat ggcactgctc gagtacagcg catccgagat cgaggcgctg      2400
     ctgcccacgt atcccaagct cgaggtctgc gtttacgcag ctccgacgca cacggtgatc      2460
     ggtggaccgc agccggacat cgaggcgatc gtcgcggccg ccgaggccga cggcaagatg      2520
     gcgcgtgtcc tgcagaccaa gggtgccagc catacttcac aggtggatcc gctgctcggc      2580
     gagcttgccg cggagttggc cggtatcgag ccgaccacgt tgaagctcgg cgtctactcg      2640
     tccgtcgaca aggacacctt ctaccgtccc ggtcacgagc cgatccatca agaggcgtac      2700
     tgggtcaagg gccttcgcca cagcgtgtac ttcaccaatg cggtacgcgg tgcagttgcc      2760
     cacggccaca ccacttttgt cgagcttgca cccaacccgg tgacgctgat gtcggtggcg      2820
     gctaccgcgt tcgattcggg cctgcacgac atggaactca tccagacgct caagcgtaag      2880
     gaagacgagt ccgcgggtgt gcttgccgct ctcgcgcagc tgtacgtgca cggccatgcc      2940
     gtgaacctcg agtccttgct tcctgcaggc gatttcgcct cggttccgcg tactgcattc      3000
     ctgcgtaagc cgtactggct cgacattcgc gtcagtgccg gcggttcggc tcgcgtaccc      3060
     ggttcgcacg tcgctctgcc cgacggccgc cacgtgtggg aggtcgacgc atccgccgtc      3120
     accgatctgg ctgtgctcgt gagcgctgct gccggacagg tgctctcgga tgtcgctctc      3180
     accgctgccg ttccgcacgg tgaactggcc ggcgctgcga ccctgacgac aaccctcaac      3240
     ccgcatccgg gtggagcgtc ggtgcaggtg cacgcacgcg agggctctac gttccgtttg      3300
     ctgttcgatg ccgtcgtcac gtccggtgag ccgctgcccg agctggtcat tagcgcgccg      3360
     gtcaagacca gtgcgccgat ggaaaccctg gccgaggtcg tcgaagacgc cggagacaag      3420
     tgggatccga acggttcgca gagcctcgac gaccgcctca agatcgttgt ggccgagtcg      3480
     atggggtact cgccggaaga tcttccggcc gaggttccgc tcatcgaact gggtctcgat      3540
     tcgctcatgg cgatgcgtat caagaaccgc gtcgagtacg agttcgacat tccgcagctc      3600
     cagctccagg cagtcaagga cgcgagcctc aacgaggtca acaagtacct gcgctacgcg      3660
     atcgacaatc gcgaagaggt tcaggcgatg gccgacaagc aggctgccga gaagttggca      3720
     gccgatgcgg ctgacgagga cgctgctccc gctgaggagt cggtggaact gccggcgact      3780
     gctccggttg ctgctgcgcc ttccgatcct tctcgagccg gaactgccga cgatgccggc      3840
     tccgacgttc cgccgcgaga tgcggccgag cgcttgacgt ttgcgacgtg ggccgtcgtc      3900
     accgggaagt ccgccaaggg tattttcaac gatctgccga tcgtcggtga cgaggtcgcc      3960
     gagaagcttg ctgctcggct ttccgagcgt gcgggcggcg agatcactct cgacgacgtt      4020
     ctcgattcca ccaccatcga agagctcgcg gacgtcgtgc gccagtacct cgaggacgac      4080
     ggcaagatcg acggactcgt gcgcactctg cgtgcccgtc ccgaaggttc cactgccgta      4140
     ccggtattcg tcttccatgc tgccggtggt tcgaccgtga cgtacgagcc tttgctcaag      4200
     cgcctgcccg ccggcacgcc gatgtacggg ttcgagcggg tcgagggctc gatcgaaacc      4260
     cgtgctgctg cttacgttcc gctgctgcgt gagatccagg gcgacggacc gtacgtgctg      4320
     tgtggctggt cgttcggcgg cgtgatgtcg tatgcggtcg cgaagttgct gcgtgagcag      4380
     ggcgctgacg tgcgtgtggt cggactgctc gacaccgtca tggccggcga ggtcgtgccg      4440
     gacaccgagg cggaacgacg caagcgttgg gagcgctacg gcaagttcgc caagcgcacc      4500
     tacaacctgg atgttccgct gccgcttgac gttctggcct ccaccgaagc ggacgaagat      4560
     cagatccaga tcttgatgga catgatcaag atgagcggcg ccaagattcc cggcggcatc      4620
     atcgagcatc agcggacgtc gtggttggac aaccgtgcca tccagacggc cgagttcagc      4680
     agctacgacg gcgacgtcgt gctctacatg gccgacaagt accacgacga gttgatgacg      4740
     ctcgagcctg cattcaagac ccgcaaggca gatggtggtt ggggtgacta cgtgaagaac      4800
     ctcgaggtcg tctacatcgg cggggaccac ctgcagatcg tcgacgagcc gtacatcgcg      4860
     aaggttgcgg cagacctcac caccaagctg gcccagatcg agacagctca gaccaaagca      4920
     gcggaaaccg gagttcagaa gtga                                             4944
//

If you have problems or comments...

PBIL Back to PBIL home page