(data stored in ACNUC1104 zone)

EMBL: AP008957.PON1

AP008957.PON1        Location/Qualifiers
FT   CDS_pept        complement(515723..518110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pon1"
FT                   /gene_synonym="ponA2"
FT                   /locus_tag="RER_04630"
FT                   /product="penicillin-binding protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31171"
FT                   /db_xref="GOA:C0ZNB9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB9"
FT                   /protein_id="BAH31171.1"
FT                   /translation="MSIAKTVAKLAGSSALAGVLVAGVMFPVAGGFGFASNRAADTVDN
FT                   VSAELVEGTVPAVSTMVDAAGNPIAWLYDQRRFEVPSEKISNNMKLAIVSIEDRRFPDH
FT                   KGVDWQGTLRAFLTNTTTGEVQQGASTLDQQYVKNYQLLVVAKTDAERRAAIETTPARK
FT                   IREIRMALTLDKELTKDEILTRYLNLVPFGNGSFGIQDAAQTYFGVDAADLTVPQSAML
FT                   AGMVQSSSALNPYTNVEGVTERRNTVLDTMITNIPDRADEFRAAKEEPLGVLETPNNLP
FT                   RGCIAAGDRGFFCDYALKYLSDAGITRDQINEGGYLIKTTLDPQVQASTKAGLNANASA
FT                   NLDGIANVMNVIRPGQDSHKVIAMASSRTYGLNADADETVQAQPYSLAGDGAGSVFKIF
FT                   TTAAAMEKGLGINATLDVPKRFEAKGMGSGGAAGCPVSTYCVENAGNYPPTLSVTDALA
FT                   QSPNTAFVKLIEATGVTPTVDMAVRLGMRSYADPNTSGFDERSMADFQKEQNLGSFTLG
FT                   PTWINPLELSNVAATLASHGKWCPPSPIDSVFDRYGKPVAVTEQGCEQVVEPGLADTLA
FT                   NAMSRDDVGAGTSAGAASSAGWSLPMSGKTGTTETHKSSAFLGFTNNLAAAVYIFGDSP
FT                   TPGEICSSPLRPCYSGNLYGGTEPARSWFAAMNPVANNFGPTSLPPIDEKYARGSQNGQ
FT                   VPEVVGLSQSAATSRLQASGFTVNSVTTASGARAGTVTGVSPSGSAIPGSTVTIYISDG
FT                   SVRAPAAPASPAAPAAPAPGATPPDATPPGREPAPPAGTPPN"
     gtgtcgattg caaaaacagt ggcgaagctc gccggaagct ccgcattggc gggtgtcctg        60
     gtcgcagggg tgatgttccc agtggcgggc ggattcggat tcgcgtccaa ccgcgccgcc       120
     gataccgtcg acaacgtctc ggccgaactg gtcgaaggca cggtccccgc ggtgtccacc       180
     atggtcgatg cggcaggcaa tcccattgcc tggctctacg accaacgacg cttcgaagtc       240
     ccgagcgaga agatctccaa caacatgaag ttggcgatcg tctccatcga ggaccgccgg       300
     ttccccgacc acaagggcgt cgactggcag ggaacgctgc gtgccttcct caccaacacg       360
     acgaccggtg aagtgcagca gggcgcgtcg acactcgatc agcagtatgt gaagaactac       420
     caactgttgg tcgtggccaa gacggatgcc gagcgccgcg ctgccatcga gaccaccccg       480
     gcccgaaaga tccgcgagat ccggatggcc ctgacgctgg acaaggaact cacgaaagac       540
     gagatcctca cccggtacct caacctcgta ccgttcggca acggatcctt cggcatccag       600
     gacgcggctc agacctactt cggcgtcgat gccgcagatc tgaccgttcc ccagtcggcg       660
     atgcttgccg gcatggttca gtccagctcc gcactgaacc cgtacacgaa cgtcgagggc       720
     gtgaccgagc gtcgtaacac cgtgctcgac accatgatca cgaacattcc ggatcgtgcc       780
     gacgagttcc gcgcagccaa ggaagagccc ctcggcgtcc tggaaacccc caacaacttg       840
     ccgcgcggct gcatcgctgc aggcgatcgc ggattcttct gtgactacgc actgaagtac       900
     ctctcggacg ccggaatcac ccgcgaccag atcaacgagg gtggttatct catcaagacc       960
     actctcgatc cgcaggtcca ggcgtccacc aaggccggac tgaacgcgaa cgcgagcgcc      1020
     aacctcgacg gcatcgccaa cgtcatgaat gtgatcaggc cgggccagga ttcacacaag      1080
     gtcatcgcga tggccagcag tcgcacgtac ggactcaacg ccgacgccga cgaaaccgtc      1140
     caggcacagc cgtactccct tgcgggtgac ggtgcgggtt ccgtcttcaa gatcttcacg      1200
     acggctgcgg cgatggagaa gggcctcggc atcaacgcga cgctcgacgt gcccaagcga      1260
     ttcgaagcca agggcatggg tagcggtggt gcggccggtt gcccggtgtc gacttactgc      1320
     gtggagaacg ccggcaacta cccgccgacg ctgtcggtga ccgacgcgct ggcacagtcc      1380
     cccaacaccg ctttcgtcaa gctcatcgag gcaaccggcg tcacgccgac cgtcgacatg      1440
     gccgtccgtc tcggcatgcg ctcgtacgct gatcccaaca cctcgggctt cgacgagcgc      1500
     agcatggccg acttccagaa ggaacagaac ctcggttcgt tcaccctcgg tcccacctgg      1560
     atcaacccac tcgaactctc caacgtcgcg gccactctcg cctcgcacgg caagtggtgc      1620
     ccgccgagtc ccatcgattc ggtcttcgac cgctacggca agcctgtggc cgtcaccgag      1680
     cagggctgtg agcaggttgt cgagcccggc ttggcagaca cactcgccaa cgccatgagc      1740
     cgtgacgacg tcggcgccgg tacgtctgcc ggagctgcaa gcagcgccgg atggagcctg      1800
     ccgatgtcgg gcaagacggg taccaccgag acccacaagt cctcggcgtt cctcggcttc      1860
     accaacaacc tcgctgctgc cgtctacatc ttcggcgact ccccgacgcc gggagagatc      1920
     tgctctagcc cgctgcgccc ctgctacagc ggcaacctgt acggcggtac cgaaccggcg      1980
     agatcctggt tcgcggcaat gaacccggtc gccaacaact tcgggcccac ctcactgcct      2040
     ccgatcgacg agaagtacgc acggggatcg cagaacggcc aggttcccga ggttgtcggc      2100
     ctgagccagt cggcggcgac gtcgaggttg caggcgtccg gcttcacggt caattccgtg      2160
     accacggcgt ccggagcacg cgcgggaacg gtcaccggag tttcgccgtc cgggtccgcg      2220
     atcccgggtt cgaccgtcac gatctacatc agtgacggtt ccgtgagggc tccggcagca      2280
     cccgcatccc cggcagctcc agcagctccg gcaccgggcg cgactccccc ggatgcgact      2340
     ccgcccggac gcgaacccgc accgcctgcg gggaccccgc cgaactga                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page