(data stored in ACNUC1104 zone)

EMBL: AP008957.PSTP

AP008957.PSTP        Location/Qualifiers
FT   CDS_pept        complement(38349..39773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstP"
FT                   /gene_synonym="ppp"
FT                   /locus_tag="RER_00320"
FT                   /product="probable serine/threonine protein phosphatase
FT                   PstP"
FT                   /EC_number="3.1.3.16"
FT                   /note="protein synonym:phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30740"
FT                   /db_xref="GOA:C0ZLH2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH2"
FT                   /protein_id="BAH30740.1"
FT                   /translation="MTLVLRYAARSDRGLVRSNNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLMIAALAHLDDDEPGEDLLGKLEAATREGNDSIADHVEEEPELDGMGTTLTAILFS
FT                   GSKLGLVHIGDSRAYLLRDDHLTQITRDDTFVQSLVDEGRITAEQAHTHPQRSLIMRAL
FT                   TGNEIEPTLTVREARAGDRYLLCSDGLSDVVSDETIENTMREGSQEQCADRLIELALRS
FT                   GGPDNVTVVVADVIDLDYGQSHPIVAGAASTEEEEDSPPPNTAAGRAAAMRPPRATPKR
FT                   VVSQPEPEPKKKRNRLWWVVLAVVLIALVGVGAVIGRAVIRNNYYVGEDNGRVTVLRGI
FT                   PGSVLGYSLQDADLVGCVGDDDVLTLVSPDAIPSNCNILEVTDLQPSAQEQVRAGLPSG
FT                   KREDAQSQMIRLIGGDLLPRCEPVPTTTATPTPPPAPETTPPPAPPAEPATPTTAAPTT
FT                   TPTPTEVPGQTCRTVN"
     gtgacccttg ttctccgcta cgcggcgcgc agcgaccgcg gtctcgtgcg ctccaacaac        60
     gaagattccg tctacgccgg tgcacgcctg ctggctttgg ccgacggcat gggcggacac       120
     gcggccggtg aggtcgcgtc gcagttgatg attgccgccc tggcgcatct cgacgacgac       180
     gagcccggcg aggatctgct cggcaagctc gaggcagcca cccgcgaggg caacgattcc       240
     atcgccgatc acgtcgagga agaacccgaa ctcgacggca tgggcaccac gctcaccgcg       300
     atcctcttct ccggcagcaa gctcggcctc gtacacatcg gcgactcgcg cgcctacctt       360
     ctgcgtgacg accacctgac gcagatcacc cgcgacgaca cgttcgtgca gtcgttggtc       420
     gacgagggtc ggatcaccgc cgaacaggca cacacgcacc cgcagcgatc cctgatcatg       480
     cgggcgttga ccggcaacga gatcgagccg acgctcactg tgcgcgaagc ccgcgccggc       540
     gatcgttacc tgctctgctc cgacggcctc tccgacgtgg tcagcgacga gaccatcgag       600
     aacacgatgc gcgagggctc gcaggagcag tgcgccgacc gtctcatcga attggcgctg       660
     cgcagcggcg gtcccgacaa cgtcaccgtc gtcgtcgccg atgtcatcga cctcgactac       720
     ggccagtcgc atcccatcgt cgcgggcgcc gcgtcgacgg aagaggaaga ggactcccct       780
     ccccccaata ccgcagccgg ccgcgccgct gccatgcgtc cgccgcgcgc gacgcccaag       840
     cgagttgtct cacaacccga accggaaccg aagaaaaagc ggaaccgatt gtggtgggtg       900
     gtcctcgccg tggtgctgat cgcactggtc ggcgtcggcg ccgtgatcgg ccgcgccgtc       960
     atccgcaaca actactacgt cggcgaagac aacggccgcg tgacggtgct gcgcggaatc      1020
     cccggttcgg tgctcggtta ctcgctgcaa gacgcggatc tggtgggttg cgtcggcgac      1080
     gacgacgtcc tcactctcgt ctcccctgac gcgattccca gcaactgcaa catcctcgag      1140
     gtcaccgatc tgcagccgtc ggcgcaggag caggtgcgcg ccgggctgcc gtccggcaag      1200
     cgtgaagatg cgcagagcca gatgatccgt ctcatcggcg gcgatctgct gcctcgttgt      1260
     gagccggttc cgacgacgac ggccacgccc actcccccgc cggcaccgga gaccacgccg      1320
     ccccccgcac cgcccgcgga gccggccacg ccgacgacgg cggcacccac gactacgccg      1380
     acgccgaccg aagttcccgg tcagacttgc aggacggtca actga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page