(data stored in ACNUC1104 zone)

EMBL: AP008957.RMLC

AP008957.RMLC        Location/Qualifiers
FT   CDS_pept        complement(289435..290028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmlC"
FT                   /locus_tag="RER_02480"
FT                   /product="dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="protein synonym:dTDP-4-keto-6-deoxyglucose
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30956"
FT                   /db_xref="GOA:C0ZLX9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLX9"
FT                   /protein_id="BAH30956.1"
FT                   /translation="MSQYRELKVPGAWEFTPKQFGDDRGVFLEWFREPGFSEITGRTLD
FT                   LQQANCSVSAAGVLRGIHFADVPPGQAKYVTCVKGAILDIAVDLRVGSPTFGQWDSVLL
FT                   DDVDRRAIFLSEGLGHAFLSLEDNSTVVYLCSTGYAPEREHEVHPLDPDIAIDWPTVGR
FT                   SGEPLNITLSAKDTAAPSLQDAVSAGLLPTFGEG"
     atgagccagt atcgcgaact gaaagtgcca ggggcctggg aattcacacc caaacagttc        60
     ggcgacgacc gtggagtctt cctcgagtgg ttccgtgaac ccggattctc cgagatcacc       120
     ggccgcaccc tcgaccttca gcaggccaat tgctcggtct ctgctgccgg cgtcctacga       180
     ggcatccatt ttgccgacgt ccctcccgga caggccaagt acgtcacgtg tgtcaaaggc       240
     gcgatactcg acatcgccgt cgacctccgc gtgggatcgc cgaccttcgg ccagtgggat       300
     tcggtccttc tcgacgacgt cgaccgccga gcgatctttc tgtccgaagg gctcgggcac       360
     gccttcctgt ccctcgagga caactcgaca gtggtttacc tgtgctcgac gggatacgcc       420
     cccgaacgtg agcacgaagt tcaccccctc gatcccgaca tagcgatcga ctggcccacc       480
     gtgggtcgca gcggtgagcc cctgaacatc acgctctccg cgaaggacac agcggcaccg       540
     tcgcttcaag atgccgtgtc ggcagggctg ctgcccacgt tcggcgaagg ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page