(data stored in ACNUC1104 zone)

EMBL: AP008957.RODA

AP008957.RODA        Location/Qualifiers
FT   CDS_pept        complement(36898..38349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="RER_00310"
FT                   /product="probable cell division protein RodA"
FT                   /note="protein synonym:rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30739"
FT                   /db_xref="GOA:C0ZLH1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH1"
FT                   /protein_id="BAH30739.1"
FT                   /translation="MSSNAAAGTAFPSPPGGFAPAPVQSTRRNMELLLLGFAVIITTVS
FT                   LLLVEASQEQKITLDLAKYALAYTGLFLIAHLAIRRYAPYADPLLLPIVALLNGLGLVL
FT                   IHRLDLADEQTALYNGVEAPSPDANQQVMWTALAITGFVLLLVFLKDYRLMARFSYTLG
FT                   LAGLVFLAIPAILPAKFSSVNGAKIWIRLPGFSIQPGEFAKILLIIFFASVLVAKRDLF
FT                   TSAGKHFLGMDFPRARDLGPILLAWIVSVGVLVFETDLGTSLLLFSTVLVMLYIATERV
FT                   GWLVIGGGLLAIGFFFAYKMFGHVRVRVDTWLDPLGDYANTGYQISQSLFGLATGGIAG
FT                   TGLGSGRPNQVPFAKTDFIIATIGEELGLIGLAAVLMLFLLLIVRGLRTALAVRDSFGK
FT                   LLAAGLSFTIAIQIFVVVGGVTKLIPLTGLTTPFMSYGGSSLLANYLLLAILVRISDAA
FT                   RAPVVTKKKGPPPIADANTEMMPRV"
     atgtcgtcca acgcagctgc ggggacggct tttccgagtc cgcccggagg ttttgccccg        60
     gcgccggtcc agtcgacccg tcgaaacatg gagctgctgc tcctgggctt tgccgtcatc       120
     atcacgacgg tctcgcttct gctcgtcgag gcgagccagg aacagaagat cacgctggac       180
     ctcgccaagt acgcgctcgc gtacacgggc ttgttcctga tcgcgcactt ggcaattcgg       240
     cgctatgcgc cgtacgccga tccgctgctg ctgccgatcg tcgccctgct caacggcctg       300
     gggttggtgc tcatccaccg gctcgacctc gccgacgaac agacagcgct ctacaacggc       360
     gtcgaggcac cgtctccgga tgcgaaccag caggtcatgt ggactgcact ggcgatcacc       420
     ggattcgtgc tgttgctggt gttcttgaag gactaccgcc tgatggcgcg gttcagctac       480
     acgctcggcc tcgcaggcct ggtgttcctg gcgattcccg cgatcctgcc ggcgaagttc       540
     tcgagcgtga acggcgcgaa gatctggatt cgcctgcccg gattcagcat tcagccaggt       600
     gagttcgcga agatcctgct catcatcttc ttcgcgtccg tgctcgtcgc caagcgcgac       660
     ctgttcacct cggccggtaa acacttcctg ggcatggatt ttccgcgtgc ccgcgacctc       720
     ggtccgatcc tgctcgcctg gatcgtctcg gtgggcgtgc tcgtcttcga aaccgacctc       780
     ggtacgtcgt tgctgctctt cagcaccgtg ctggtgatgc tctacatcgc gaccgaacgt       840
     gtgggctggc tggtgatcgg cggcggactg ctcgccatag gattcttctt cgcctacaag       900
     atgttcggac acgtgcgcgt gcgcgtcgac acctggctgg acccgctcgg cgactacgcc       960
     aacaccggtt atcagatctc gcaatcgctg ttcggcctgg ccaccggtgg tatcgccgga      1020
     acaggtctgg gcagcggccg ccccaaccag gtgccgttcg cgaagacgga cttcatcatc      1080
     gcgaccatcg gcgaagagct cggcctgatc ggcctggccg ctgtgctgat gctgttcctg      1140
     cttctcatcg tgcgcggcct gcgtacggcg ttggcagtgc gcgacagctt cggcaaactg      1200
     ctcgccgccg gtctgtcgtt caccatcgcg atccagatct tcgttgtcgt cggcggcgtc      1260
     accaagctga tcccgctgac gggtctgaca acaccgttca tgtcgtacgg cggctcgtcg      1320
     ctgctcgcga attacctact gctggccatc ctcgtccgga tctcggacgc ggctcgtgcg      1380
     ccggtagtga cgaagaagaa aggtccgccc ccaatcgctg acgccaatac cgagatgatg      1440
     ccgcgcgtat ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page