(data stored in ACNUC1104 zone)

EMBL: AP008957.SERS

AP008957.SERS        Location/Qualifiers
FT   CDS_pept        216186..217439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="RER_01960"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="protein synonym:SerRS"
FT                   /note="protein synonym:serine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30904"
FT                   /db_xref="GOA:C0ZLS7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS7"
FT                   /protein_id="BAH30904.1"
FT                   /translation="MIDLKFLRENPEIVRESQRTRGEDPGLVDALLEADASRRAAVLTG
FT                   DNLRAEQKAFGKKVGQASPEERPALLEGSKELAAKVKEAEAAQHEAQAALDAAHRAISN
FT                   VVQEGAPAGGEDDYIVLEHVGEIPKFDFEPKDHLELGESLGLIDMERGAKVSGSRFYFM
FT                   TGYGAMLQLGLLQLAAQKAIANGFTMMIPPVLVRPEIMAGTGFLGAHSDEIYHLQDDDL
FT                   YLVGTSEVPMAGYHSGEILELNEGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFTYCRPEDADAEHQRLLGWERDMLAAIDVPYRVIDVAGGDLGSSAARKFDCEAWVPTQ
FT                   GTYRELTSTSNCTTFQARRLGVRYRDENGKPQTAATLNGTLATTRWIVSILENHQQADG
FT                   SVRVPEALVPFVGTDVLR"
     gtgattgacc tcaagtttct ccgtgagaac cccgaaatcg tccgcgagtc gcagcgcacc        60
     cgtggagaag atccaggact ggtcgacgct ctgctcgaag ccgacgcgtc ccgacgcgct       120
     gccgttctga ccggagacaa cctccgcgca gagcagaagg ccttcggcaa gaaggtcgga       180
     caggcatctc cggaggagcg tcccgcgctg ctcgagggtt ccaaggaact ggcggccaag       240
     gtcaaggaag ccgaggccgc gcaacacgag gcgcaggccg cgctcgacgc cgcacaccgc       300
     gcgatttcca acgtcgtaca agaaggtgcg ccggccggcg gcgaggacga ttacatcgtg       360
     ctcgaacacg tcggtgagat tccgaagttc gactttgagc cgaaggatca cctcgagctg       420
     ggtgagtcgc tcggcctgat cgacatggaa cgcggcgcca aggtttcggg ttcgcgcttc       480
     tacttcatga ccggctacgg agccatgctc cagctcggac tgctgcagtt ggcggcgcag       540
     aaggcgatcg ccaacggatt cacgatgatg attccgccgg tgctcgtacg cccggaaatc       600
     atggcgggta ccgggttcct cggtgctcac tcggacgaga tctaccactt gcaggatgac       660
     gacctgtacc ttgtcggaac ttccgaggta cccatggccg gctaccactc gggcgagatc       720
     ctcgaactga acgaaggccc gaagcgctac gccggttggt cgtcgtgctt ccgccgcgag       780
     gccggaagct acggcaagga cacccgcggc atcatccgtg tccatcagtt cgacaaggtc       840
     gagatgttca cgtactgccg tcccgaggat gccgacgccg aacaccagcg tctcctcggc       900
     tgggagcgag acatgttggc ggccatcgac gttccgtacc gcgtgatcga cgtcgccggc       960
     ggagatctcg gttcttcggc tgcgcgtaag ttcgactgcg aggcatgggt tccgacgcag      1020
     ggcacctacc gcgagctgac atcgacgtcc aactgcacga ctttccaggc ccgccgcctc      1080
     ggagttcggt accgcgacga gaacggcaag ccgcagacgg ctgccactct caacggcacc      1140
     ctggctacga cgcgctggat cgtgtcgatt ctcgagaacc atcagcaggc cgacggctcg      1200
     gtgcgagtgc ccgaggcatt ggtgccgttt gtcggcacgg atgtgcttcg ctga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page