(data stored in ACNUC1104 zone)

EMBL: AP008957.UREB

AP008957.UREB        Location/Qualifiers
FT   CDS_pept        331761..332198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="RER_02890"
FT                   /product="urease beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30997"
FT                   /db_xref="GOA:C0ZM20"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM20"
FT                   /protein_id="BAH30997.1"
FT                   /translation="MASKSTKKDSGGEKKVPVGGYVLRDEPIELNEGRPRLKLRVRNTG
FT                   DRPIQVGSHYHFMEVNRALSFDREQSFGWRLDIPAGTAVRFEPGDEKEVTLVPFGGKQR
FT                   VQGFNGLVDGWAPTHAAYRPRLPGAVQRAEELGFLSEPQTD"
     atggcaagca aatcgacgaa gaaggattcc ggcggcgaga agaaagtgcc ggtcggcgga        60
     tacgtgttgc gggacgagcc gatcgaactg aacgagggcc gtccccgttt gaagttgcga       120
     gtccgaaaca ccggtgaccg tcccatccag gtgggttcgc actatcactt catggaagtc       180
     aatcgcgcgt tgtccttcga tcgtgaacag tccttcggct ggcgcctcga cattccagcg       240
     ggcacggcgg tcagattcga gccgggcgac gaaaaggaag tgacgttggt gccgttcggc       300
     ggcaagcaac gggttcaagg cttcaacgga cttgtcgacg gttgggcgcc gacccacgcc       360
     gcctaccgcc ctcggcttcc cggagccgtc cagcgtgccg aagaactcgg cttcctgtcc       420
     gaacctcaaa ccgactga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page