(data stored in ACNUC1104 zone)

EMBL: AP008957.URED

AP008957.URED        Location/Qualifiers
FT   CDS_pept        335955..336902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="RER_02940"
FT                   /product="urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:RER_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31002"
FT                   /db_xref="GOA:C0ZM25"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZM25"
FT                   /protein_id="BAH31002.1"
FT                   /translation="MSATSVPGASRSLPGPIPTIPELDQYQDQPKQAPAGKVGKTGVLE
FT                   MRFVDRGDKTILRDMYRKTPLLVQQALYWDEALPTMPCVYMISTSGSVLQGDRLFLTIE
FT                   MEPGSLAHVTTQSATKVHRMDANHASQLQKVVLAENSYLELMPGVTIPHRNARYYARTD
FT                   ITVDPTATLLFSEIVMSGRKYHDGGEMFVYDLYSTMIKAERPDGKNLFTEKLVIEPARF
FT                   PVRYGGIMGDHDVFGNVILLTPKEHADAILEEIVPGRDGKVVSGASRLPNDAGLIFKVL
FT                   GPESEPVKAKVRDFWSLVRKAVLDTTIPPVPLWG"
     gtgagcgcaa cgtccgtccc gggagcatcg cggtcgctcc cggggccgat cccgaccatc        60
     ccggaactcg accagtacca ggaccagccg aagcaggccc cggccggcaa ggtcgggaag       120
     accggcgttc tcgagatgcg atttgtcgac cgtggcgaca agacgattct gcgggacatg       180
     taccgcaaga caccgctgct cgttcagcag gcgctgtact gggacgaagc gttgccgacc       240
     atgccgtgcg tctacatgat ctcgacgtcc ggcagtgtgt tgcaaggcga tcgactgttc       300
     ctgaccatcg agatggaacc gggttccctc gcgcacgtga ccactcagtc ggccaccaag       360
     gttcaccgga tggatgccaa tcacgcgtcg caactccaga aagtggtgct cgcggagaat       420
     tcgtatctcg aactgatgcc cggggtgacg atcccacacc gcaacgcgag gtactacgcg       480
     cgcaccgaca tcacggtgga tccgactgca acgctgttgt tctcggagat cgtgatgtcg       540
     ggtcgcaagt accacgacgg cggagagatg ttcgtctacg acctgtactc cacaatgatc       600
     aaggcggagc gtccggacgg gaagaacctc ttcaccgaga aattggtgat cgaaccggca       660
     cgcttccccg tgcgatacgg cggaatcatg ggtgaccacg acgtgttcgg caatgtcatc       720
     ctgctgacac cgaaggagca cgccgacgcc attctcgagg agatagttcc gggccgtgac       780
     ggcaaggtcg tttccggagc gagtcggcta ccgaacgacg ccggtctcat cttcaaagtc       840
     ctcggtccgg agagcgaacc cgtcaaggcg aaggttcgtg atttctggtc tctggtgcga       900
     aaggcagttc tggacaccac cattccgccc gtcccgctct ggggatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page