(data stored in ACNUC1104 zone)

EMBL: AP008957.YRBE1A

AP008957.YRBE1A      Location/Qualifiers
FT   CDS_pept        complement(758496..759275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1A"
FT                   /locus_tag="RER_06790"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31387"
FT                   /db_xref="GOA:C0ZPQ9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ9"
FT                   /protein_id="BAH31387.1"
FT                   /translation="MFSNLLSEIGLLFTFTVRVCVAAFTTLRHKRLAWREALDQMWFLA
FT                   HVTSVASALVMIPLGVGVALQIGSLADQIGAGSYSGAVVAFLIIGQAGPLVCALIIAGV
FT                   GGSAICADLGARTIREEIDALEVLGLPVLERLVVPRMIAIAVVCLLLNSIVLVIGLGAS
FT                   LFVHVLILDGNAQSFLRNLVQFSQPSDFVVSGIKAVAFALISGIVACYKGLTVKRGAQG
FT                   VGDAVNETVVLSFVLVFVANLAITQFYPLFVSVKGAY"
     atgttctcga acctgctgtc cgagatcgga ctgctgttca ccttcaccgt tcgcgtatgc        60
     gtcgccgctt tcacaactct gcgacacaag cgcctcgcct ggcgtgaagc gctcgaccag       120
     atgtggtttc tcgcccacgt cacctcggtc gcatcggcac tggtgatgat tcccctcggc       180
     gtgggcgtag ctctccagat cggttcgctc gcagaccaaa tcggcgcggg ttcatacagc       240
     ggtgcagtcg tcgcgttcct catcatcgga caggccggac cgctggtctg cgccctgatc       300
     atcgccggcg tcggcggttc cgcaatctgc gcagatttgg gagcgcgcac gatccgcgaa       360
     gagatcgatg cgctcgaagt actgggcctg ccggtgttgg aacgcctggt cgtgccgcgg       420
     atgatcgcaa ttgccgtcgt ctgcctcctg ctgaattcga tagttctcgt gatcggtttg       480
     ggcgcaagcc tcttcgttca cgtcctgata ctcgacggca acgcacagag cttcctgcgc       540
     aatctcgttc aattcagtca accgagcgac ttcgtcgtct ccggtatcaa agccgttgcc       600
     tttgctctca tctcgggaat cgtggcctgc tacaagggcc tgaccgtcaa gcgcggagct       660
     caaggcgtcg gcgacgcagt caacgagacc gtcgtgctct cgtttgtcct cgtgttcgtc       720
     gccaacctcg caattaccca gttctacccg ctgttcgtct cggtgaaggg tgcctactga       780
//

If you have problems or comments...

PBIL Back to PBIL home page