(data stored in ACNUC1104 zone)

EMBL: AP008957.YRBE1B

AP008957.YRBE1B      Location/Qualifiers
FT   CDS_pept        complement(757651..758496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE1B"
FT                   /locus_tag="RER_06780"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31386"
FT                   /db_xref="GOA:C0ZPQ8"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ8"
FT                   /protein_id="BAH31386.1"
FT                   /translation="MHLPIAIRAKRASSRTVDGLSRLGDQFTFHARVITSIPATLKRYW
FT                   REVARLVAQVAFGSGTLLAGGGSVVVIFAISFFAGSQIGLEGYRGLNLVGLAPLSGVMS
FT                   AIANTREVAPLVAAITLAAKVGTGFTAQLGAMRISEEIDALEVMAIPSLRYLVTTRMIA
FT                   ALIAVVPLYLVGLFASYMATALAVIRVKGQSEGTYGYYFSLFLSPNDIWLSLIKVMVFA
FT                   VVVTLVHCYYGYTATGGPEGVGRAAGRALRTSIVFLAFTDVAMTIALWGLKPQVPGLTG
FT                   "
     atgcacctgc ccatcgcaat tcgtgccaag cgggccagtt cgcgcaccgt cgacggtctg        60
     agtcgactcg gcgatcagtt cacgttccac gcgcgcgtca tcacctcgat tccggcaacc       120
     ctcaagcgat attggcgtga agtcgcccgt ctcgtcgccc aggtggcatt cggttcgggc       180
     accctgctcg ccggcggcgg cagcgtcgtc gtgatcttcg cgatctcgtt cttcgcaggt       240
     tcccagatcg gactcgaggg ctaccgcgga ctcaacctcg tcggcctcgc accgctgtcc       300
     ggcgtgatgt ccgccatcgc gaatactcgt gaggtcgcac cactcgttgc cgcaatcacc       360
     ttggctgcca aggtcggaac tggattcacc gcgcagctcg gagccatgcg gatctccgag       420
     gaaatcgacg cactcgaagt catggcgatt ccctcgctgc gatacctggt caccacccga       480
     atgatcgcgg cgctcatcgc ggtggtcccg ctgtacctgg tcggcctgtt tgcttcgtac       540
     atggcaacgg cgcttgcggt gatccgggtc aaaggccagt cggagggaac atacggctac       600
     tacttcagtc ttttcctctc tcccaacgac atctggttgt ccttgataaa agtcatggtg       660
     ttcgcggtcg tcgtgaccct cgtgcactgc tactacggtt ataccgcgac gggtggacct       720
     gaaggcgtcg gacgagcagc cggacgagcg ctgcgcacca gcatcgtctt cctggccttc       780
     accgacgtcg ccatgaccat cgcgctctgg ggactcaaac ctcaggtgcc cgggttgacc       840
     ggatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page