(data stored in ACNUC30630 zone)

EMBL: AP009044.PE102

AP009044.PE102       Location/Qualifiers
FT   CDS_pept        114466..115392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53059"
FT                   /db_xref="GOA:A4QA16"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA16"
FT                   /protein_id="BAF53059.1"
FT                   /translation="MFDELTARAHNSALRSIARVVAETVEPMGEDVARVGVVKQLKAGN
FT                   VLAVTGAGVSTDSGIPDYRGPKGSLSRHRPMTYQEFRHDPAASHRYWARSFVGWRVMDQ
FT                   ARPNRTHYAMVELEQHGFLSGVVTQNVDGLHAEAGTKNLVALHGDLAHVMCLNCGFGED
FT                   RHLFDERLEAANPGYVASIRLEPGAVNPDGDVFLDEEQVRRFTMIGCLRCGSLMLKPDV
FT                   VYFGEPVPAARKKDLKKLLDASSSLLIAGSSLAVMSGYRIVIEAQRQGKQVSVINGGPG
FT                   RADSRVDILWRTRVAPAFDDILDALDL"
     gtgtttgatg aactcactgc tcgtgcccac aattcagcgt tgaggtctat tgctcgtgtc        60
     gtcgcggaga cggtagagcc aatgggggag gatgtggcga gggtgggcgt cgtaaagcaa       120
     ttaaaggccg ggaacgtgct ggcggtgact ggggctgggg tgtcgacgga ctcgggcatc       180
     cctgattatc gcggcccaaa gggcagcttg agcaggcatc ggccgatgac gtaccaggag       240
     tttcggcatg atccggcggc gtcgcatcgc tattgggcgc ggtcgtttgt ggggtggcgg       300
     gtgatggatc aggcgcggcc gaatcgaacg cactacgcca tggttgagct ggagcagcat       360
     ggttttttaa gtggtgtggt cacccaaaat gtcgatggtt tacatgcgga agcaggcaca       420
     aaaaacctgg tcgcgctgca tggtgatctc gcccatgtga tgtgtttgaa ctgcggtttc       480
     ggggaggatc gacacctctt tgatgaacgt ctcgaagccg ccaaccccgg ctacgtcgct       540
     tccattcgcc tggaaccggg cgcagtcaat cccgacggcg acgtcttcct cgacgaagaa       600
     caagtacgcc gcttcaccat gatcggctgc ttgcgctgcg gctcgctcat gctcaaacca       660
     gacgtggttt acttcggcga acccgtgccc gccgcgcgca aaaaagattt aaaaaagctt       720
     ctcgacgcct cctccagcct cttaatcgcc ggctcctccc tagccgtcat gagtggatac       780
     cggatcgtca tcgaagcgca acgtcaagga aaacaagtgt ctgtcatcaa cggcggccca       840
     ggtcgggcgg attcccgcgt ggacattttg tggcgcaccc gcgttgcacc ggcctttgat       900
     gacattttgg acgcgctgga cctttag                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page