(data stored in ACNUC30630 zone)

EMBL: AP009044.PE105

AP009044.PE105       Location/Qualifiers
FT   CDS_pept        117791..118624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53062"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA19"
FT                   /protein_id="BAF53062.1"
FT                   /translation="MNNVQQFHRFFDDSAVYYPCFVPLDRAIGEHFDRQNKPMSRFIGT
FT                   LILPLAKLEEAAQYTGDEVLRVSAVISTDELADLRRDFYELPNIDIASVEIKLVGAALT
FT                   NTAWLGDVEKLIQQHRNTFVWVEIPTALVTADIVRKLRHMGAGLKYRTGGDREELFPTP
FT                   QDLITVLRTAIDAALPFKLTAGLHRALRYRDEKTGRLHFGFLNIAATVATLRAGKGEAE
FT                   ALSVLEGDDAAPLIHALQIGGNWRDSFRSFSTCNVVEPLNTLIDLDVLAEGDVHP"
     atgaacaacg tgcaacagtt tcatcgattt tttgatgatt ccgcagtcta ttatccctgc        60
     ttcgtcccgc ttgaccgagc catcggcgaa cactttgatc gtcagaacaa accgatgtcc       120
     agattcatcg gaacgctcat tcttccgcta gccaaactgg aagaagccgc ccaatacacc       180
     ggcgatgaag tccttcgcgt gtcggcagta atcagtactg atgagctcgc tgatctgcga       240
     agggattttt acgaactccc caacatcgac atcgcctcgg tggaaatcaa gctggtcggc       300
     gcagccctca ccaacaccgc ttggttgggt gatgtggaaa aactcatcca acaacatcgc       360
     aacactttcg tatgggttga gattccgaca gccctggtca ccgcagatat tgtccgaaaa       420
     ctccgccaca tgggagctgg actgaaatac agaactggag gtgataggga agagctcttc       480
     ccaacacctc aagacttgat caccgtactg cgcactgcca tcgatgccgc attgccgttt       540
     aaactcactg caggcctgca tcgtgctctc aggtatcgtg acgagaaaac cggccgactt       600
     cacttcggat tcctcaacat tgcagccacc gtggcgacac ttcgtgctgg aaagggcgaa       660
     gcagaagccc tatcggtcct tgaaggtgat gatgccgcac cacttattca cgcactgcaa       720
     attggtggaa actggcgaga ttccttccgc agcttcagca cctgcaatgt tgttgaacca       780
     ctcaacactc tgattgatct tgatgtgctg gcggaaggag acgtacatcc ctaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page