(data stored in ACNUC30630 zone)

EMBL: AP009044.PE116

AP009044.PE116       Location/Qualifiers
FT   CDS_pept        complement(128828..130654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53073"
FT                   /db_xref="GOA:A4QA30"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA30"
FT                   /protein_id="BAF53073.1"
FT                   /translation="MQESSRDNFQVDLGGVVDLLSRHIYSGPRVYVRELLQNAVDACTA
FT                   RSEQGEEGYEPSIRIRPVTKDRATFSLVDNGTGLTAQEARELLATVGRTSKRDEFGLQR
FT                   EGRLGQFGIGLLSCFMVADEITMVSHAEGASAIRWTGHADGTFNLEILGDDATDVIPVG
FT                   TTVHLTPRPDERTLLTENSVVTIASNYGRYLPIPIVVQGEKNTTITTSPVFAKDTDQQH
FT                   RLYAGRERLGKTPFDVIDLTGPGIEGVAYVLPEAQAPHMSRRHSIYVNRMLVSDGPSTV
FT                   LPNWAFFVECEINSTDLEPTASREALMDDTAFAATREHIGECIKSWLINLAMTKPHRVR
FT                   EFTAIHDLALRELCLSDADLAETMLGLLTLETSRGRISIGEITTLSITEDVSLQLATTL
FT                   DDFRQLNTIARPDTLIINGGYIHDSDLARLIPVHYPPLTVSTADLRESMDLMELPPLQD
FT                   VEKAKALDAQVTDSLKDFQIKGATRVFDPADVPAVVIIDSKAQASRDRNETQSATTDRW
FT                   ADILATVDNTLSRQTANIPQDQGLSALCLNWNNSLVRKLASTDDTAVVSRTVRLLYVQA
FT                   LLSSKRPLRVKERTLLNDSLADLVSLSLSSDI"
     atgcaagaat cctcacgtga taatttccaa gttgacctcg gcggcgttgt tgatcttttg        60
     agtcgccaca tttattccgg tccgagggtg tatgtgcgtg agttgctgca gaatgcggtt       120
     gatgcttgta ctgcacgttc tgaacagggt gaggagggct acgagccgag tattcgtatt       180
     cggccggtga ccaaggatcg tgccacgttt tcactggttg ataatggtac gggcctgacc       240
     gcgcaggagg cgcgggaatt gctggcgacg gtgggacgga cgtcgaaacg cgatgaattc       300
     ggtctgcagc gggaaggtcg cctggggcaa tttggcatcg ggctgcttag ttgtttcatg       360
     gtggcggatg agatcaccat ggtgtcgcat gcggagggtg cgtcggcgat tcggtggact       420
     ggtcatgcgg atggcacgtt taacctggag attcttgggg atgacgcaac cgatgtcatt       480
     ccggtgggca cgactgtgca cctgacaccg cgccctgatg agcgcacgtt gctgacggaa       540
     aattccgtgg tcaccattgc tagtaattat ggccgctacc tgccgattcc tattgtggtg       600
     cagggtgaga aaaacaccac catcactaca tcgccggtgt ttgcaaagga tactgatcag       660
     cagcacaggc tgtatgccgg ccgggagcgc cttggtaaaa ctccttttga tgtcatcgat       720
     ctcactggcc ctggcatcga gggtgtggct tatgtattgc cggaggctca ggctccgcat       780
     atgtccaggc gtcacagtat ttatgtcaac cgcatgttgg tctctgatgg gccttccacg       840
     gtgctgccca actgggcgtt ctttgtggaa tgtgaaatca attcaaccga tttggaaccc       900
     accgcatcgc gtgaagcgct catggatgac accgcgttcg cggcaaccag ggaacatatc       960
     ggtgagtgca ttaaatcgtg gctgattaac ctcgccatga ccaagcctca ccgcgtgcgg      1020
     gaatttactg cgattcatga tcttgccctg cgcgagctgt gcctatcgga cgcggacctg      1080
     gctgaaacca tgttgggtct tctcaccttg gagacctccc gtggtcgcat ctcgatcggt      1140
     gagatcacca cgttgtccat caccgaggat gtatcgctgc agttggccac cacgttggat      1200
     gatttcaggc agctcaacac cattgcacgc cccgatacct taattattaa tggcggctac      1260
     attcacgaca gcgacctggc taggctcatt ccagttcact accctccgct gacggtatct      1320
     accgctgacc tgcgcgaatc catggatctg atggagcttc cgccgctgca ggatgtagaa      1380
     aaagccaagg cactggatgc acaagtcacg gactcgctga aggatttcca gatcaagggc      1440
     gcaacgagag tttttgaccc cgcggatgtt cctgccgtgg tgattattga ttctaaggcg      1500
     caggcctcac gggatcgcaa tgaaacacaa agtgccacca ctgatcgttg ggctgacatt      1560
     ttggcaacgg tggataacac gttgagccgt caaacagcca acattccaca agatcaggga      1620
     ctatccgcgt tgtgcttgaa ttggaacaat tcgctggtaa ggaaattggc ctccactgat      1680
     gacaccgccg tggtgtcgcg cacggtgcgt ctgctctacg tgcaggcgtt gctgtccagc      1740
     aaaaggccac tgcgggtgaa ggaacgcacg ctgcttaatg attcgctggc agatctggtt      1800
     tctttgtctt tgtcatccga tatctaa                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page