(data stored in ACNUC30630 zone)

EMBL: AP009044.PE127

AP009044.PE127       Location/Qualifiers
FT   CDS_pept        142991..144190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53084"
FT                   /db_xref="GOA:A4QA39"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA39"
FT                   /protein_id="BAF53084.1"
FT                   /translation="MNHGPGLTFRFLTAQVLVVVISLLVAAAVATMVGPTLFHDHMLMT
FT                   GREDPSLELFHAEQAYRDANLITLAVALPTALISALLASLWLSRRLRTPLQDLTRAATS
FT                   LTAGNYRIRVPAGEAGPEVTTLAHAFNTMADRLEHTEQVRRQMLSDLAHEMGTPLSVLT
FT                   VYFDGLQDGVVDWNNATHTIMADQLTRLTRLMEDIDDVSRAQEHRIDLDLAEEGLGDLL
FT                   HTAAAAAGEAYADKGVDLQVETITDTVRVLVDRQRFGQVMSNLLSNALRHTPAGGQVRI
FT                   SVRRQGASTALIHVADDGEGIPPGQLGHIFERFYRGDAARSRDNGGAGIGLTISKALIE
FT                   AHGGTLTATSPGPGAGSVFTIRLPLHQENVSLMLGDPTPGDNNSDDLGSDPYQPLDNTP
FT                   "
     atgaatcacg gacccggcct gaccttccgc ttcctgaccg cccaggtgtt ggtcgtggtg        60
     attagcctgc tggtggccgc ggccgtggcc acgatggtgg gcccgaccct gttccatgat       120
     catatgttga tgaccggccg ggaggacccc tcgctggagc tgttccatgc cgagcaggcc       180
     taccgggacg ccaacctgat caccctggcc gtcgccctgc ccaccgcctt gatcagcgcc       240
     ctgctggcca gcctgtggtt atcgcgtcgc ctgcgcaccc ccctgcagga tctcacccgc       300
     gccgctacca gcctgacggc cggcaactac cgtatccgcg tgcccgccgg agaagcaggc       360
     cccgaggtca ccaccctggc gcatgccttc aacaccatgg ccgaccggct ggaacacacc       420
     gaacaggtcc gccgccagat gctctctgat ctggcccacg aaatgggcac ccccttatcg       480
     gtgctcacgg tctacttcga tggtctccag gacggggtcg tggactggaa taatgccacc       540
     cacacgatca tggctgacca actcacccgc ctgacccggt tgatggaaga catcgacgat       600
     gtctcccggg cccaggaaca ccggatcgat ttggacctgg cggaggaagg gctcggggat       660
     ctgctccata ccgccgctgc tgccgcgggg gaagcttatg ctgacaaagg cgtcgattta       720
     caggtcgaga ccattacgga caccgtccgg gtgctcgtgg accggcaacg cttcggccag       780
     gtgatgagca atctcctgtc gaacgcgcta cggcacaccc cggccggcgg gcaggtccgg       840
     atcagcgtcc gccgacaggg ggcgtccacc gcgctcatcc acgtcgccga tgacggcgag       900
     ggcatcccac ctggccagct cggacacatc ttcgaacgct tctaccgggg ggatgccgcc       960
     cgcagccggg acaacggcgg ggccggtatc ggtctgacca tctccaaggc attgatcgag      1020
     gcccacggcg gcactctcac cgccacctct cctggccccg gtgccggatc ggtcttcacc      1080
     atccgtcttc ccctgcacca ggaaaacgtg tccctgatgc tcggtgaccc cactcccggg      1140
     gacaataatt ctgatgacct cggcagcgat ccgtatcaac cccttgacaa taccccatag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page