(data stored in ACNUC30630 zone)

EMBL: AP009044.PE131

AP009044.PE131       Location/Qualifiers
FT   CDS_pept        complement(147872..148357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53088"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA43"
FT                   /protein_id="BAF53088.1"
FT                   /translation="MAVIISRRSSYCPNFATAPINTGRCDHAEQGHRGQGGRGSEHVSG
FT                   ADQADASQWHIVATRAHVLPSLLGKGEQAFLGIQIRPQARDTANDFVHKALALPETLAL
FT                   YNVSGNEDYLVHVAVSDSTALQALIIDKFLALPQVAHCRTQLIFGDPWVAPLQHSPE"
     atggctgtga ttatttcacg tcgctcttcc tactgcccca actttgcaac agcaccaatt        60
     aatacaggtc gatgcgacca tgccgaacaa ggacatcgcg gccaaggtgg gcgtggctcc       120
     gagcacgtgt ctggagcgga tcaggcggat gcgtcgcaat ggcacatcgt cgcgactcgc       180
     gcccatgtgc tcccgagcct gcttggcaag ggcgagcagg cgtttctcgg tatccagatc       240
     cgcccgcagg cacgagatac cgccaacgac ttcgtgcaca aagccctcgc gctgccggag       300
     actcttgcgc tctacaacgt gagtggtaat gaggactacc tcgtccacgt cgcggtgtct       360
     gatagtacag cgctgcaggc tctgatcatt gacaagtttc ttgccctgcc gcaggtcgcg       420
     cattgccgga cccagctgat cttcggcgat ccgtgggtag ccccgttaca gcactctcca       480
     gagtga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page