(data stored in ACNUC30630 zone)

EMBL: AP009044.PE137

AP009044.PE137       Location/Qualifiers
FT   CDS_pept        complement(151712..152029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53093"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA48"
FT                   /protein_id="BAF53093.1"
FT                   /translation="MAEVTFASLHEKMNFLLKDHGVENFDESDLDLESVSSLHAKANAL
FT                   CAAHGGDPSRMANDTLAQLHPKLDFLMKGHGVDTDTARLDLSTLEAVDAKVNAVVNAHD
FT                   H"
     atggccgaag tgacctttgc cagtctccac gagaagatga acttcctgct caaggaccac        60
     ggggtcgaga acttcgacga gtcggatctg gacctcgaat ccgtctcctc actgcacgcc       120
     aaggcgaacg cgttatgcgc cgcccacggc ggtgacccct cccgcatggc gaacgatacc       180
     ctcgcccagc tgcacccgaa gctggacttc ctgatgaagg ggcacggcgt ggacaccgac       240
     actgcccgcc tggacttgag cacactggag gctgtggatg ccaaggtcaa cgccgttgtc       300
     aacgcccacg atcattag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page