(data stored in ACNUC30630 zone)

EMBL: AP009044.PE138

AP009044.PE138       Location/Qualifiers
FT   CDS_pept        complement(152234..152470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53094"
FT                   /db_xref="GOA:A4QA49"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA49"
FT                   /protein_id="BAF53094.1"
FT                   /translation="MTAPATLKNTTLRSDEFTCPSCVAKIENKLNGLDGVENAEVKFSS
FT                   GRILITHDPQKVSVRDLVTAVAEVGYTAKPSAI"
     atgaccgccc cggccacgct gaagaacacc accttgcgct ctgatgagtt cacctgtccg        60
     agctgtgtcg ccaagatcga aaacaagctg aatggtttgg acggcgtgga gaatgcggag       120
     gtgaagttct cctccggacg catcctgatc acccacgacc cacagaaggt ctccgtacgt       180
     gacctggtca ccgcggtagc cgaggtcggt tacaccgcca agccgtcggc gatctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page