(data stored in ACNUC30630 zone)

EMBL: AP009044.PE149

AP009044.PE149       Location/Qualifiers
FT   CDS_pept        complement(158905..160926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53105"
FT                   /db_xref="GOA:A4QA60"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA60"
FT                   /protein_id="BAF53105.1"
FT                   /translation="MTHPVNNTPTATDTTAGTTPTIGSRPQERVHPTWPLYLLFFTVAG
FT                   AIGGTVAYSFLGESLAALGIPNPGIATTFGLPFFRAVGWMLAALSAGSFLFAAFLISPR
FT                   LPGGDHDRLHQASLSVDGHLASRTGAVAAICFGLIALLMIPLVLSDVSGTPLAQTLGLE
FT                   TLTVAVEQVAMAQVWLIVALIALVTGGTGLMSRAWITQPLLLLGSILMIIPLGLTGHSS
FT                   SGGNHDHGTNSYLWHLVFLVLWVGGLMALLAHGRRLGPDLDIALRRYSTIALVSIIVMA
FT                   VSGLVNAAIRIELTDLLTTRYGLIIVAKTIGVIILGVFGWIHRAWVIPQVQANPADRRL
FT                   FRQVAIVEVLVMAAVTGIAITMGRTPPPPPRIPNLSQMATKLGYELSEKPTILNVWGMW
FT                   RFDLLFGALALLLAVGYLSAVWRTRQTGHTWSSTPTAWWLAGCVTLLVTMSSGIGLNMP
FT                   AVFSVHMVGHIILSLVIPIFLVMGAPLTLLMTAFAPGAPGRPNIHDWVRAFTRSRLVGV
FT                   ITHPVVNTLQFLVFFYVMYLFIPLYELLISKYAGQLIMNTVLLVSGSIYFWGLMEPDPV
FT                   PHRRPAPVRLAWLLASLPVHVGFGVYLSQLTTVMGEEFYRSLLLPWDIDLLADQHAAVT
FT                   AWAIGGIPLLLAIILLIRQWRDIRRRPHDQAPLAVPAE"
     atgacccacc cggtaaataa cacccccact gccacggata cgaccgcagg gacgaccccc        60
     accatcggga gccggcctca ggagcgggta caccccacgt ggccgttgta cctgctcttt       120
     ttcaccgtcg caggtgccat cggcgggacg gttgcctaca gcttcctcgg cgaatccctc       180
     gcggccctgg ggatccccaa cccgggcatc gcgaccacct tcgggttgcc gtttttccgt       240
     gcggtcggtt ggatgctcgc tgccctgtcg gccggttctt tcctgttcgc tgctttcctc       300
     atctccccac ggttgcccgg cggtgatcac gaccgcctgc accaggcctc gttgagtgtg       360
     gacgggcacc tggcctcgcg taccggtgcg gtcgcggcca tctgcttcgg actgatcgcg       420
     ttgttgatga tcccgctggt gctctcagat gtctccggca cccccctggc ccagacactc       480
     ggcctggaga ccctgacggt ggccgtcgag caggtggcca tggcccaggt gtggctgatc       540
     gtcgcgctta ttgccctggt caccggtggt acgggcctga tgagccgggc gtggatcacc       600
     caaccactgt tgctcctcgg gtcaatcctc atgatcatcc ccctgggcct gacagggcac       660
     tcctcctcgg gcggcaacca cgaccacggc accaactcct acctgtggca cctggtcttc       720
     ttagtcctgt gggtcggcgg actcatggcc ctgctcgccc acgggcgtcg cctaggacct       780
     gacctggata ttgcgctgcg ccgctactcg acaatcgccc tggtctccat catcgtcatg       840
     gccgtgtccg ggctggtcaa cgccgccatc cgcatcgagc tgacggatct gttgaccacc       900
     cggtacgggt taatcatcgt ggccaagacc atcggcgtga tcatcctcgg tgtcttcggg       960
     tggatccacc gggcgtgggt cattccgcag gtgcaggcca accccgctga tcgccgactg      1020
     ttccgccagg tcgccatcgt cgaggtgctt gtcatggcgg cggtcaccgg tatcgccatc      1080
     accatggggc gcaccccgcc gcccccaccg cgcatcccga acctctcgca gatggccacc      1140
     aagctcggct acgagctgtc cgagaagccc accatcctca acgtgtgggg catgtggcgc      1200
     tttgacctgc tgtttggtgc cctcgccctg ctgctggccg tcggctatct ctccgctgtg      1260
     tggcgcaccc gccagacagg tcacacctgg tcaagcaccc ccaccgcctg gtggttggcc      1320
     ggatgtgtga ccctgctggt gacgatgagt tccgggatcg ggctgaatat gcccgcggtc      1380
     ttctcggtgc acatggtcgg tcacatcatc ttgtcgctgg tcatccccat cttcctggtg      1440
     atgggtgccc cgctgaccct gctgatgacc gccttcgccc cgggggcccc gggtaggccg      1500
     aatatccacg attgggtgcg cgccttcacc cgcagccggt tggtgggggt gatcacccat      1560
     ccggtggtca acaccctgca gttcctggtg ttcttctacg tcatgtacct gttcatcccg      1620
     ctctatgagc tgctgatctc caagtacgcg gggcagctga tcatgaacac cgtgctcctg      1680
     gtctccggtt cgatttattt ctggggactc atggaaccag acccagttcc gcatcgccga      1740
     ccagccccag tgcgcctggc ctggctcctg gcttccctgc cggttcatgt cggcttcggg      1800
     gtgtaccttt cccaactgac cacggtcatg ggcgaggagt tctaccgctc gctcctcctg      1860
     ccctgggaca tcgacctgct tgccgaccag cacgccgccg tcaccgcctg ggccatcggt      1920
     gggattcccc tgctcctggc gatcatcctg ttgatccgcc agtggcgcga catcaggaga      1980
     cgaccccacg atcaggcacc actagcagtg ccagcagaat aa                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page