(data stored in ACNUC30630 zone)

EMBL: AP009044.PE159

AP009044.PE159       Location/Qualifiers
FT   CDS_pept        complement(170447..171598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53115"
FT                   /db_xref="GOA:A4QA68"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA68"
FT                   /protein_id="BAF53115.1"
FT                   /translation="MAKIGRPGLPQDQRQKVWDLWKTGSSISDISRDVGSPPGSIFSIL
FT                   LPRGGIYLPAQKHHPGTLTLAEREEISRGLSVGLSYRAIARLTGRSASTISREVTRNRG
FT                   RTAYRAIDADDRSWRQARRPQRCKLAKNPVLRGYVAARLREDWSPEQIAGRLKITYACT
FT                   SRMQISHESIYKSLFIQSRGVLPKDLQKHLRSRRPIRKARSNTTSGQWRSQIKDAVSIS
FT                   KRPKEAEARVQVGHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRE
FT                   LGQLPDQAKRSLTWDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYF
FT                   PKKTSMKGFSQTDLDQVADKLNNRPRKVLGFRTPAEQYEALLR"
     atggccaaga tcggacgacc cggcttaccc caagatcaac gccagaaagt ctgggacctg        60
     tggaaaaccg gttcctctat cagcgatata tcacgcgacg tcggttcccc accaggatca       120
     atcttttcca ttctcctgcc ccggggaggg atctatctcc cggcccagaa acaccaccca       180
     ggcactctca ccctggccga gcgcgaggaa atatcccgcg gcttaagtgt gggattatcc       240
     taccgcgcga tcgcacgact gacaggtcgc agcgcgtcga cgatcagtcg tgaagtaacc       300
     cgtaacaggg gacgcacggc ctaccgtgcc atagatgccg atgaccgctc atggcgacag       360
     gcgcgtcgac cccagcgctg caaactcgcc aagaaccccg tcctacgcgg atacgtggcc       420
     gcgcgtctgc gcgaggactg gtcaccggag cagatcgccg gacgactcaa gatcacctac       480
     gcgtgcacct ctcggatgca gatctctcac gagtcgatct acaagtcact gttcatccag       540
     tccagaggcg tcctgcccaa agacctgcag aaacatctcc gttcccgccg gccgatcagg       600
     aaggcacgct ccaacaccac cagtgggcag tggcgctccc agatcaagga tgcagtgtcg       660
     atctcgaagc gcccgaagga ggcagaagcc cgcgtccagg tgggccactg ggagggagat       720
     ctcgtcatcg gcgcccagca gtcacagatc gccacggtga tcgaacgggc aacccgattc       780
     acacgggtgg tccacgtcga gtccagacat gcggcgtcgg tgacagctgg tctgatacgg       840
     gaactggggc agctgccgga tcaggcgaag cgttcgttga cgtgggaccg gggaatggag       900
     ctggccggcc acaaggaggt caccgccggc acggggatga cggtgtgctt cgctgatcct       960
     cactcaccct ggcaacgcgg aacaaacgaa aataccaacc ggttgctgcg gcagtatttc      1020
     ccgaagaaaa catcgatgaa gggcttcagt cagacggacc tggatcaggt ggccgataag      1080
     ctcaacaacc gtccccggaa ggttctggga ttccgcaccc ctgctgagca gtatgaagca      1140
     ctgttgcgtt ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page