(data stored in ACNUC30630 zone)

EMBL: AP009044.PE168

AP009044.PE168       Location/Qualifiers
FT   CDS_pept        177561..178154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53124"
FT                   /db_xref="GOA:A4QA77"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA77"
FT                   /protein_id="BAF53124.1"
FT                   /translation="MVTGLLSAIGLFIATNIDDIIVLSLFFARGAGQKGTTLRILAGQY
FT                   LGFMGILAAAVLVTLGAGAFLPAEAIPYFGLIPLALGLWAAWQAWRSDDDDDDAKIAGK
FT                   KVGVLTVAGVTFANGGDNIGVYVPVFLNVDTAAVIIYCIVFLVLVAGLVLLAKFVATRP
FT                   PIAEVLERWEHVLFPIVLIALGIFILVSGGAFGL"
     gtggtaaccg gtctactgtc ggcgattggt ctgtttattg ccaccaatat cgacgacatc        60
     atcgtgctct cgctgttttt tgcccgcggg gcggggcaaa aagggaccac gcttcggatt       120
     ctggcgggtc agtacctcgg cttcatgggc atcctcgcgg ccgcagtcct ggtcacgctg       180
     ggggcaggag cattcctacc cgctgaggcg atcccgtact tcggactaat tcccctggcc       240
     ctgggactat gggcggcctg gcaggcctgg cgaagcgatg acgacgatga tgatgcgaag       300
     atcgccggga aaaaggtggg tgtgctgacc gtcgccggtg tgacgtttgc caacggtggc       360
     gacaatatcg gtgtctacgt cccggtcttc ctcaacgtgg acactgccgc cgtcatcatc       420
     tactgcatcg ttttccttgt cctggtggca ggcctggtcc tgctggcaaa gttcgtggcc       480
     acccgaccgc ccatcgcaga agtccttgag cgctgggagc acgtgctgtt cccgatcgtc       540
     ctgatcgccc tgggcatctt catcctcgtc agcggcggcg ccttcggcct ctaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page