(data stored in ACNUC30630 zone)

EMBL: AP009044.PE178

AP009044.PE178       Location/Qualifiers
FT   CDS_pept        complement(187252..187968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53133"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA86"
FT                   /protein_id="BAF53133.1"
FT                   /translation="MTSEGRAGRSHHDSHRWVQKYAPELDKHTRWYRQAPDWQASSWRV
FT                   DETYIRVGGRWCYLYRAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNASAGFPRVIN
FT                   TDKAPSLAKAISELKEEGICPPTVEHRQVKYLNNVLEGDHGRLKRILGPKGAFKNLDIC
FT                   ISDAEGDGSDALLAERSGDDVCLRATEPGRGDRQPGLRDGLRTLSRRDHGEMKLGRSWP
FT                   LHPTLQQHLITHVNEE"
     atgacctcag aggggcgtgc cggtcgatca caccacgatt ctcaccgctg ggtccagaaa        60
     tacgcccctg agctggacaa gcacactcgg tggtaccggc aggcacctga ctggcaggcc       120
     agttcctggc gggtggatga gacctatatt cgggtcggcg gcaggtggtg ctatctctac       180
     cgtgcgatca ccgctggtgg gcagaccctg gacttttatc tctctccgaa gcggaacgtc       240
     gcggcagcga agcgtttcct ggccaagacc ctgcggtcga acgcgtcagc cgggttcccg       300
     cgggtgatta atacagataa ggcaccctcc ctggccaagg cgatctccga gctcaaggaa       360
     gaaggcatct gcccaccgac agtggagcac cgtcaggtga aatacctgaa caacgttctc       420
     gagggagatc atgggcggct gaaaaggatc ctggggccga agggtgcatt taagaactta       480
     gacatctgca tatcagacgc tgaaggggat ggaagcgatg cactccttgc ggaaaggtca       540
     ggggacgatg tttgcttacg ggcaaccgaa cccggacgcg gtgatcgtca gccgggtctt       600
     cgagacggcc tgagaacgct gagtcgcaga gaccatggag aaatgaaact cgggcgttcg       660
     tggcccctcc acccgacttt gcaacagcac ctcatcaccc acgtcaatga agaatag          717
//

If you have problems or comments...

PBIL Back to PBIL home page