(data stored in ACNUC30630 zone)

EMBL: AP009044.PE186

AP009044.PE186       Location/Qualifiers
FT   CDS_pept        197632..197949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53141"
FT                   /db_xref="GOA:A4QA94"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A4QA94"
FT                   /protein_id="BAF53141.1"
FT                   /translation="MRIHEDPGLQPERTVLAWNRTTVSLAVCSAILLRWTNFYGIFALL
FT                   PVVILSGMAIFILFTQRVRYERQAIGLADNKLPPNIVGVVSLTVTLLAFGAAGIVFVFI
FT                   D"
     atgcgcattc atgaggatcc aggtttgcag cctgagcgga cggtgttggc gtggaatcgt        60
     acgacggtgt ccttggctgt gtgttcggca attttgctga ggtggactaa tttctatggg       120
     atttttgcac tgctgccggt ggtgattctc agcggaatgg cgattttcat cttgtttacg       180
     cagcgggttc gttatgaacg tcaggctatc gggcttgcgg ataataaatt gccacctaat       240
     atagttgggg ttgtttcttt aacggtgaca cttttggcgt tcggggccgc tggaattgta       300
     ttcgtcttca ttgattaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page