(data stored in ACNUC30630 zone)

EMBL: AP009044.PE208

AP009044.PE208       Location/Qualifiers
FT   CDS_pept        complement(215258..216532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53161"
FT                   /db_xref="GOA:A4QAB4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB4"
FT                   /protein_id="BAF53161.1"
FT                   /translation="MSFRDIFADTRPLKEPAFKRLWLGNVATVIGAQLTVVAVPVQIYQ
FT                   MTGSSGYVGLTGLFGLIPLVIFGLYGGSIADAFDKRIVLICTTIGMCVTTAGFWVLTIL
FT                   GNENIWLLLINFSLQQAFFAVNQPTRTAILRSILPIDQLASATSLNMLLMQTGAIVGPL
FT                   IAGALIPLIGFGWLYFLDVVSIIPTLWAVWSLPSIKPSGKVMKAGFASVVDGLKYLAGQ
FT                   PVLLMVMVLDLIAMIFGMPRALYPEIAEVNFGGGDAGATMLAFMYSSMAVGAVLGGVLS
FT                   GWVARISRQGVAVYWCIIAWGAAVALGGVAIVVSPGAVTAWAWMFIIMMVIGGMADMFS
FT                   SAVRNAILQQSAAEHVQGRIQGVWIIVVVGGPRLADVLHGWAAEPLGAGWTVLWGGVAV
FT                   VVLTAICMVAVPKFWKYEKPKITGI"
     gtgagtttcc gagatatttt cgctgacacc agaccgctga aagaaccggc cttcaaacgc        60
     ctctggcttg gcaatgttgc caccgtcatt ggtgcccaat taactgttgt tgccgttccg       120
     gtgcagattt accaaatgac tgggtcctcc ggctatgtgg gcttgaccgg gctttttggc       180
     cttattcctt tggttatttt tggcctttat ggtggatcca ttgcggatgc ttttgataaa       240
     cgcatcgtgc tgatctgcac cacgatcggc atgtgtgtca ccactgccgg tttttgggtg       300
     ctgaccattt taggcaatga gaatatttgg ctcctgttaa taaacttttc tttacagcag       360
     gcatttttcg cggtgaatca acccacccga acggcgatcc ttcgaagtat tttgccgatt       420
     gatcaattag cgtcggcaac atcactgaat atgctgctca tgcagaccgg cgcaatcgtt       480
     ggcccgctga tcgcaggtgc gttgattccg ctgatcggtt tcgggtggct gtatttcctt       540
     gatgttgtct ccatcatccc cacactgtgg gctgtatggt cgctgccttc gatcaagcca       600
     tccggcaagg tcatgaaggc tggtttcgcc agtgtggtgg atggcctgaa gtatttggct       660
     ggccaacccg tgttgttgat ggtgatggtg ctggatctta tcgccatgat tttcggcatg       720
     ccacgtgcgc tttaccccga gatcgcagaa gtgaacttcg gtggtggtga cgccggtgca       780
     acgatgctgg cgttcatgta ctcatccatg gctgttggcg cagttcttgg cggcgtgctg       840
     tctggttggg tggcccggat tagccgccag ggtgttgcag tttattggtg catcatcgcc       900
     tggggcgcag ccgttgcttt gggtggtgtg gcaattgttg tcagccccgg cgcggtgact       960
     gcgtgggcgt ggatgttcat catcatgatg gtcattggtg gcatggctga catgttcagc      1020
     tcggcagttc gaaacgctat tttgcagcag tctgctgcgg aacatgtgca gggccgaatc      1080
     caaggtgtgt ggatcatcgt cgtggtgggt ggacctcgtt tagctgacgt ccttcacggt      1140
     tgggccgctg agcccttggg cgcaggttgg acggtattat ggggcggagt agcggtggtt      1200
     gtactcactg caatttgtat ggtggcggtg cctaaattct ggaaatacga gaaaccaaaa      1260
     attaccggca tctaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page