(data stored in ACNUC30630 zone)

EMBL: AP009044.PE212

AP009044.PE212       Location/Qualifiers
FT   CDS_pept        219500..221050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53165"
FT                   /db_xref="GOA:A4QAB8"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAB8"
FT                   /protein_id="BAF53165.1"
FT                   /translation="MSNPSLEPLEPLEPIELSDGTEIEVPDVDPEPQAGNAQMEVPSLR
FT                   TYVFRGIIAIACLVIGFYESFVLLWQNLRIGVANYSLLVVLMAIVLFIGLDRKRARALN
FT                   IHDREVDYIIGVIAVLIAITIKSQLLPRFVDWETLLRLDMFALLFFAFGISGLVFGMRS
FT                   TFSFAPGWILLFGYNAVAHLIISVIFGGGFWGPVMANIIGLSLAVLVSSNRDLVQATYL
FT                   ALMTVLFGVIFAIIVWALTDGSKFLTLVPAVLATITVVLVSSRWRLGQWKIRRRQPTVE
FT                   KAGPALIAVVVATALLAWIPTPYVERVNNLPGLQMLAKPAPGVIAPIGWHIDDVQYYNW
FT                   ASRYFGPGSSLLRQTMTADHYNEAWDPDGLDRTVVVDTLQSAERFQQHAFGDETLYSTL
FT                   RGRKSDTVQVDLGYGVVGRAYTVLDETDFLTYTKLVFEWQTTNNTVEKISVIAVDDHRA
FT                   EAKFPELAPSVTRMFIQVVTILFRGNGVTIDTNTQLKDLDLVSQVGRQIVAEQQVGRS"
     atgagtaacc cgtcgctaga accgctagaa cctctagaac cgatcgagct ttctgacggt        60
     actgagattg aagttccaga cgttgatcca gaacctcaag ctggcaatgc gcagatggaa       120
     gtacccagct tacggacata tgtttttcgc ggaatcattg ccattgcctg tttggtcatt       180
     ggtttttatg agagctttgt gctgctgtgg caaaacctcc gaatcggagt ggccaactac       240
     tcactacttg tggtgctcat ggcgatcgtg ttgtttatcg gactggaccg caagcgtgct       300
     cgtgcattga acattcacga ccgcgaagtc gactacatca ttggtgtcat tgccgtactg       360
     atagccatca cgattaagag ccagcttctg ccacgttttg tggactggga aactctgctg       420
     cgcttggata tgttcgcact gttattcttt gcgtttggta tttccggcct ggtgtttggc       480
     atgcgctcta ccttttcttt tgcacccggc tggattttgc tgtttggtta caacgcggtg       540
     gcacacctga tcatctcggt gattttcggt ggtggctttt ggggtccggt gatggcaaac       600
     atcattggac tgtctcttgc ggtgttggtg tcctccaaca gggacctggt tcaggccacc       660
     tatttggcac tgatgacggt gttgtttggc gtcatttttg ccatcatcgt gtgggcgctg       720
     accgatggca gtaagttcct caccttggtc ccagcagtgc tggcaacgat cactgtggtg       780
     ttggtgtctt cgcgttggag gcttggtcag tggaagattc gtcgtagaca acccacggtg       840
     gaaaaagccg gacccgcgct tatcgcggtc gtggttgcga cagcactctt agcgtggatt       900
     cctactcctt atgtggagcg cgtcaacaac ctccccgggc ttcaaatgct ggcaaagcct       960
     gcgccaggtg ttatcgcacc tattggttgg cacatcgacg atgtgcagta ttacaactgg      1020
     gcttcgcgct acttcggccc cggttcctct ctgcttaggc agacgatgac ggcagatcat      1080
     tacaacgagg cgtgggatcc agatggactc gaccgaactg ttgtggtgga taccctccaa      1140
     tcggcggaac ggttccagca gcatgccttt ggtgatgaga cgctgtattc cactctgaga      1200
     ggtcgaaagt cagataccgt ccaggtagat ctgggatacg gcgtggtcgg acgcgcctac      1260
     acggtgctcg atgaaactga cttcttgacg tacaccaagc tggtttttga atggcagacc      1320
     accaacaaca ccgtggagaa gatctccgtc atcgcggtgg atgatcaccg cgcagaagcg      1380
     aaattcccgg agcttgcgcc atcggttacc agaatgttta tccaggtagt taccattttg      1440
     ttccgtggaa atggcgtgac catcgatacc aatacccaat tgaaagatct tgacctggtc      1500
     agccaagttg gccgtcagat cgtggcagaa caacaggtgg ggaggtcatg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page