(data stored in ACNUC30630 zone)

EMBL: AP009044.PE231

AP009044.PE231       Location/Qualifiers
FT   CDS_pept        complement(240083..240493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53184"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD7"
FT                   /protein_id="BAF53184.1"
FT                   /translation="MIAGSNVRSYLKAFPWMRWGFFLQNHLGCQKILPKNIKYAGTKKN
FT                   AKLRLMPVSSGFFAMIPVIAPEIPKIKGQITWCKIHGLEEPWKTTKAKIATTIQPREIS
FT                   AVGGHLVFCFDKSLVKSCFSAQPTMTSLLSIP"
     atgatagccg gctcgaacgt tcgcagctac ctgaaggcgt ttccgtggat gcgttgggga        60
     ttcttcctac aaaatcacct aggctgtcag aaaatattgc cgaaaaatat taaatacgca       120
     ggtactaaga agaatgcgaa gctaagatta atgccagtca gcagtggttt ctttgcgatg       180
     attcctgtaa ttgctccaga aattcccaag atcaaagggc aaattacttg gtgcaaaata       240
     cacggtctgg aagaaccatg gaaaactact aaagctaaaa tagcgacaac gatacaaccg       300
     agagaaatca gtgctgtggg aggccacctg gtcttttgtt ttgataaaag tttggtgaag       360
     tcttgtttct ctgcacagcc cacaatgact tccctacttt ccattccata a                411
//

If you have problems or comments...

PBIL Back to PBIL home page