(data stored in ACNUC30630 zone)

EMBL: AP009044.PE234

AP009044.PE234       Location/Qualifiers
FT   CDS_pept        241085..241777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53186"
FT                   /db_xref="GOA:A4QAD9"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAD9"
FT                   /protein_id="BAF53186.1"
FT                   /translation="MPTLFDDPLHQLPRPPRRVAAGVVHLPNFLGLAEQKALVAQARDL
FT                   AREVVGTPLAMVRPKLKSGQMSVHMLHLGKYWASNPYRYVDVVDGFPVPPLPDSFVDLA
FT                   HRALLSAGSLSNSLQSWSEAYRAEAALVNYYSPDASMGMHQDANEESEAPVISLSIGDT
FT                   GIFRLGGTLNRNKPWTDIPLMSGDLIVFGGANRRAFHGIPFIEANTAPAGCGLKEGRIN
FT                   ITIRQLAL"
     gtgcctacgc ttttcgacga tcccctccac caacttccca gaccaccgcg cagggttgca        60
     gctggcgtgg tgcacctgcc caacttcctc ggcttggccg agcaaaaggc actggtcgcc       120
     caggctcgag accttgcgcg tgaagttgtg ggcacaccgt tagcgatggt ccgacccaag       180
     ctgaaaagtg gtcagatgag tgtccatatg ttgcatttag gaaagtactg ggcatccaac       240
     ccttatcgct atgtggatgt cgttgatggt tttccagtgc caccactgcc ggattctttc       300
     gtggacttgg cacaccgagc attgctgtct gcaggatctt taagcaattc acttcagtct       360
     tggtcggagg catatcgagc agaagcggca ttggtgaatt actactcgcc agatgcttca       420
     atgggcatgc accaagacgc taatgaagaa tcggaagccc ccgtgatctc cctatcgatc       480
     ggcgacaccg gaatcttccg attgggcggc actctaaacc gcaataaacc gtggacagat       540
     atcccactaa tgagtggcga tctcatcgtt tttggaggtg caaacaggcg agcatttcat       600
     ggcattccct ttattgaggc caatactgca cctgcaggat gcgggttgaa agaagggcga       660
     atcaacatca cgatccgcca acttgcacta taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page