(data stored in ACNUC30630 zone)

EMBL: AP009044.PE256

AP009044.PE256       Location/Qualifiers
FT   CDS_pept        262338..263294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53205"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAF8"
FT                   /protein_id="BAF53205.1"
FT                   /translation="MTTSVPASTKAPSVAGENPGLRIGTAPDSWGVWFPEDPKQIPWER
FT                   FLDEVVKAGYTWIELGPYGYLPTDANQLEDELGKRGLKLSAGTVFTGFHKGEEQWKRAW
FT                   DQALDVAGLASKLGAEHLVVIPDLWRSDATNEVLEARTLDDEKWAKLAAGHDRLGKALL
FT                   EEFGMKQQFHSHADSHIGTTREVLRFLEETDARYTNLCLDTGHFAYYGGDNVKLIEQHP
FT                   ERIGYLHLKQVDPTLLFDVLKNDTPFAEAVTQGIMIEPPHGIPDLAPIIEAVSKIDSEI
FT                   FAIVEQDMYGCDIDYPFPIAERTRKHIFGCTHFARVN"
     atgaccactt ctgtacctgc atccaccaaa gctccatctg tggctggcga aaacccaggc        60
     ctgcgtatcg gcaccgcacc tgactcctgg ggcgtgtggt tcccagagga tccaaagcag       120
     atcccttggg agcgcttcct cgacgaggtc gtcaaagctg gctacacctg gatcgagctt       180
     ggcccctacg gctacctgcc aaccgatgcc aaccagcttg aagatgaact gggcaagcgc       240
     ggcctgaagc tgtccgctgg caccgtgttc accggattcc acaagggtga agagcagtgg       300
     aagcgcgcct gggatcaggc tctcgacgtt gctggtcttg cttccaagct gggtgctgag       360
     cacctcgttg ttatccctga cctgtggcgc tccgacgcaa ccaacgaagt actagaagcc       420
     cgcacccttg atgatgagaa gtgggcaaag cttgccgccg gtcacgaccg cctgggcaag       480
     gcgctgctgg aagagttcgg catgaagcag cagttccact cccacgctga cagccacatc       540
     ggcaccaccc gcgaagtact gcgcttcctg gaagaaaccg atgctcgcta caccaacctc       600
     tgcctcgaca ccggccactt cgcctactac ggcggcgaca acgtcaagct cattgagcag       660
     cacccagagc gcatcggcta cctgcacctc aagcaggtcg atccgacttt gcttttcgac       720
     gtactaaaga acgacacccc atttgccgaa gccgtaaccc aaggcatcat gatcgaacca       780
     ccacacggca tcccagactt ggccccaatc atcgaagctg tctccaagat cgactccgag       840
     atcttcgcca tcgtggaaca agacatgtac ggctgcgaca tcgattaccc attcccaatc       900
     gctgagcgca cccgcaagca catcttcggc tgcacccact tcgcacgcgt caactaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page