(data stored in ACNUC30630 zone)

EMBL: AP009044.PE261

AP009044.PE261       Location/Qualifiers
FT   CDS_pept        267861..268319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cgR_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cgR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAF53210"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A4QAG3"
FT                   /protein_id="BAF53210.1"
FT                   /translation="MSKIVDLRYRTRRSSELSKRSAEVFAEAEEHPITVTRRDGEALVL
FT                   MSQREADGRARLLELAAQLITVATDHQGTLAERMAKVFPWMLALSVADREACAREILDA
FT                   ARASFATEQPHLALTELTSWKETAAAVAAGLSNTDLQWYDDPHLVERP"
     atgagtaaga tagttgatct gcgctatcgg acccggcgtt cctcggagtt gagcaaacgc        60
     tctgctgaag tctttgccga agctgaagaa catcccatta ctgtgacacg tcgtgatggt       120
     gaagcgttgg tattgatgtc gcagcgcgaa gctgacgggc gagcccgcct gctggagttg       180
     gctgcacagt taattactgt ggccactgat catcagggca cgttagccga acgtatggcg       240
     aaagtattcc cgtggatgct ggccctgtca gtggcggatc gtgaggcgtg tgcccgtgag       300
     attcttgacg ctgcacgagc atcgtttgca accgaacaac ctcacctcgc tcttactgaa       360
     ctgacctcat ggaaagaaac agcagcagct gttgctgctg gattaagtaa cactgatctg       420
     cagtggtacg acgatccgca tctggtggag cgtccctaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page